KEGG   Pseudomonas entomophila: PSEEN0287Help
Entry
PSEEN0287         CDS       T00362                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pen  Pseudomonas entomophila
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pen03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300918..301730
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGIAPHLVGQRVSRVVVRDRRLRWPIPEDLDVRLSGQCIVSVERRAKYL
LINAEVGTLISHLGMSGNLRLVELGLPAAKHEHVDIELESGLMLRYTDPRRFGAMLWSLD
PLNHELLIRLGPEPLTDLFDGERLFQLSRGRSMAVKPFIMDNAVVVGVGNIYATEALFAA
GIDPRREAGGISRARYLKLAIEIKRVLAAAIEQGGTTLRDFIGGDGQPGYFQQELFVYGR
GGQPCKVCGTELREVKLGQRASVFCPKCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccagaggtcgagacgacgcggcgcggtattgctccgcatctggtgggc
cagcgggtcagccgcgtggtggtgcgtgaccggcgcctgcgctggccgatcccggaagac
ctcgacgtgcgcctgtcggggcagtgcattgtcagcgtcgagcgccgcgccaagtacctg
ctgatcaacgccgaggtcggcaccttgatcagccacctgggcatgtccggcaacctgcgc
ctggtcgaactggggctgccggcggccaagcacgagcatgtagacatcgagctggagtcg
gggttgatgctgcgttacaccgacccgcggcgcttcggggccatgctgtggagcctcgac
ccgctcaaccacgagttgctgatacgcctggggccagagccgttgaccgacctgttcgac
ggcgagcggctgttccagctgtcccgtggccggtcgatggcggtcaagccgttcatcatg
gacaacgccgtggtggtgggtgtgggcaacatctacgccaccgaggcattgttcgcagcg
ggcatcgacccgcgtcgcgaggcgggcgggatttcgagggcgcgctacctgaagctggcg
atcgagatcaaacgggtgctcgcggcggccatcgagcagggtgggacaacgttgcgtgat
ttcatcggtggcgatgggcagccggggtatttccagcaggaactgttcgtctatgggcgg
ggtgggcagccgtgcaaggtgtgcggcaccgaattgcgtgaggtgaagctggggcagcgg
gcaagcgtgttctgcccgaaatgccagcgttag

DBGET integrated database retrieval system