KEGG   Pseudomonas entomophila: PSEEN0368Help
Entry
PSEEN0368         CDS       T00362                                 

Definition
thioredoxin
Orthology
K03672  
thioredoxin 2 [EC:1.8.1.8]
Organism
pen  Pseudomonas entomophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(380498..380932)
Genome map
AA seq 144 aa AA seqDB search
MSDPLVIPCPHCNGLNRLPAERLGDDPKCGRCKQAVLLTRPFELTESTYAAQIKGDLPLL
LDVWADWCGPCKSFAPTFEQAARQLAGRCRLAKLDSEANRNLAGQLGIRSIPSLILFRNG
REMARQAGAFPLQSLLEWLRGQGV
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccccctggtcatcccctgcccccactgcaacggcctcaaccgcttgcccgcc
gagcgcctgggcgacgatcctaaatgcggccgctgcaagcaggcagtgctgctcacccgc
cccttcgaactgaccgaaagcacctacgccgcccagatcaagggcgacctgccgttgctg
ctggatgtctgggccgactggtgcggcccgtgcaaaagcttcgccccgaccttcgagcag
gctgcgcgccagttggccggccgctgccgcctggccaagctcgacagcgaggccaatcgc
aacctcgccgggcagctgggcatccgctcgatccccagcctgatcctgttcaggaatggc
cgcgaaatggcacgccaagccggcgccttcccgctccaatcgctgttggaatggttgcgc
ggccagggtgtctag

DBGET integrated database retrieval system