KEGG   Pseudomonas entomophila: PSEEN0449Help
Entry
PSEEN0449         CDS       T00362                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pen  Pseudomonas entomophila
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pen01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pen00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475682..476518
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLERIIARKFQEVAERSARVSLAELEAMAKSADAPRGFAKALIEQAKRKKPAVIA
EIKKASPSKGVIRENFVPADIAVSYEKGGATCLSVLTDVDYFQGADVYLQQARAAVSLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFDVSLETTLDLLPRIPRDRLAITESGILNRADVELMEINE
VYSFLVGEAFMRAEQPGVELQRLFFPDQVKKAVVQPLD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcccgacggtgctggaaaggatcatcgcccgcaagttccaggaagtggccgag
cgtagcgcacgcgtcagcctcgccgagctcgaggccatggccaagtcggccgatgcgccg
cgtggctttgccaaggccctgatcgagcaggccaagcgcaagaagccggcggtgattgcc
gagatcaagaaggcctcgcccagcaagggcgtgatccgcgaaaacttcgtgccagcagac
atcgccgtcagctacgagaagggcggtgcgacctgcctctccgtgctgaccgacgtggac
tacttccaaggtgccgacgtctatctgcaacaggcccgcgctgcggtttcgttgccggtg
atccgcaaggacttcatggtcgatccgtaccagatcgtcgaagcccgtgccctgggtgcc
gactgtgtgctgctgattgtttcggcgctcgacgatgtaaaaatggccgagttggccgcc
acggccaaggatgtcggcctcgatgtgctggtggaagtgcacgacggtgatgagctggag
cgtgcgttgaagaccctggacacgccactggtcggggtcaacaaccgcaacctgcacacc
ttcgacgtcagcctcgagaccacccttgacctgctgccgcgcattccgcgcgatcgcctg
gccatcaccgagagcggcatcctcaaccgtgccgatgtcgagctgatggaaatcaacgaa
gtgtattcgttcctggtcggtgaagccttcatgcgcgccgagcagccgggagtggaactg
cagcggctgtttttccctgaccaagtgaagaaagcagtggttcagcctctggactga

DBGET integrated database retrieval system