KEGG   Pseudomonas entomophila: PSEEN0693Help
Entry
PSEEN0693         CDS       T00362                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pen  Pseudomonas entomophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pen03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708991..711066
Genome map
AA seq 691 aa AA seqDB search
MSRSLDDLLPTALQAEHLSALAPLRDSQDLLALLDRWVERGWLRALDRAFVSFLEERAPG
SDPLVLLAAALASHQLGHGHVCLDLAQTLAEPDFALSLPPEGDALAGPLLLPSQLLASLD
LSTWLQRIGESALVANGDAIEQRSRPLVLSAQRLYLRRYWTYERHIDAALHERLARLQPQ
QDDLSLRLAQLFEGGTPGAEVDWQKLACALATRAGFSVITGGPGTGKTTTVVRLLGLLQA
PAVEQGRPLRIRLAAPTGKAAARLTESIGQQVERLQVADEVRAHIPTEVSTVHRLLGSRP
GSRHFRHHAGNPLPLDVLVVDEASMIDLEMMANLLDALPPNARLVLLGDKDQLASVEAGA
VLGDLCRDAEDGCYWPQTLAWLEQVGGQSLSGIGLKPGDGQRNPLAQQIVMLRHSRRFGE
GSGIGQLARLVNRQQAREARELLASKPQDVFCLTLGGEHDKRFDRLLLDGLNQGAEGPQG
YRGYLRAIGRLRPPPGTPADDPRWEHWAGEVLRSFEDFQLLCAVRKGAWGVEGLNERVAR
VLHNAGLIDSQQAWYEGRPVLVTRNDYGLGLMNGDIGIALRLPDDQGQSLLRVAFPRNDG
SGGVRFVLPSRLSEVETVFAMTVHKSQGSEFSHTALVLPDALNPVLTKELVYTGITRAKH
CFSLIEPRAGVFEESVGRKVRRVSGLMLEQV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaagcctcgatgacctgctgcccaccgcgctgcaagccgagcacctgagtgcg
ctggcgcccctgcgcgacagccaggacctgctggccctgctcgaccgttgggtggagcgc
ggctggctgcgcgccctcgaccgcgcgttcgtgagcttcctcgaagagcgtgccccgggc
agcgacccgctggtgctgctggcggcggccctggccagccatcagttgggccatggccat
gtttgcctggatctggcgcagaccctggccgagccggacttcgccttgtcgttgccacca
gaaggggatgccctggccgggccattgctgctgccttcgcaactgctggccagccttgac
ctgagcacctggctgcagcgcatcggcgaaagcgctctggtggccaatggcgacgccatc
gagcaacgctcccggccattggtgctcagtgcgcagcgcctgtacctgcgccgctactgg
acctacgagcggcatatcgacgccgccctgcatgagcgcctggcccgcctgcaaccccag
caggacgatctctcgttgcgcctggcgcagctattcgaaggcggtacgccgggtgccgag
gtggactggcagaaactggcctgcgccctggccacccgcgccgggttcagtgtcatcacc
ggtggccctggcaccggcaagaccaccaccgtggtgcgcttgctcggcctgttgcaggcg
cctgcggtggagcagggccgccccttgcgcattcgcctggcggcgcccaccggcaaggcc
gcggcacgcctgaccgagtccatcgggcaacaagtcgagcggctgcaggtggccgatgaa
gtgcgtgcgcatatccccaccgaagtgagcaccgtacaccgtctgctcggcagccgccca
ggctctcgccatttccgccaccatgcgggcaacccgctgccgctggatgtgctggtggtc
gacgaggcgtcgatgatcgacctggaaatgatggccaacctgctcgatgccctgccgccc
aatgcacggctggtgctgctgggcgacaaggaccagctggcctcggtggaagccggggcg
gtgctgggcgacctgtgccgcgacgccgaagacggttgctattggccccagaccctcgcc
tggctggagcaggtaggcgggcagtcgctgagcggcattggcttgaagccgggcgatggc
cagcgcaacccgctggcccagcagattgtcatgctgcgtcactcgcgccgcttcggcgaa
ggcagcggcattggccaactggcccgcctggtcaatcgccagcaggcccgggaggcccgt
gagctgctggcgagcaagccgcaggatgtcttctgcctgaccctcggtggcgagcacgac
aagcgcttcgaccgcctgctgctcgatggcctcaaccaaggggccgagggcccgcaaggc
tatcgcggctacctgcgcgccatcggccgcctgcgcccgccgcccggtacccccgccgac
gatccacgctgggagcactgggccggggaagtgctgcgcagcttcgaggacttccagttg
ctttgcgcagtgcgcaagggtgcctggggcgtcgagggcctgaacgagcgggtggcgcgg
gtactgcacaacgccgggctgatcgacagccagcaagcctggtacgaggggcgcccggta
ctggtgactcgcaacgactatggcctggggctgatgaacggcgacatcggcatcgccctg
cgcctgccggacgaccagggccaaagcctgctgcgggttgccttcccgcgcaacgacggc
agcggcggcgtgcgtttcgtcctgcccagccgcctcagcgaagtggagaccgtgttcgcc
atgaccgtgcacaagtcccagggctcggagttcagccacaccgcgctggtgctgcccgac
gcgctcaacccggtgctgaccaaggagctggtgtacaccggcatcacccgggccaagcat
tgcttcagcctgatcgagccacgggccggggtgttcgaggagtccgtcgggcgcaaggtc
aggcgtgtctccggtctgatgctggagcaggtgtga

DBGET integrated database retrieval system