KEGG   Pseudomonas entomophila: PSEEN0753Help
Entry
PSEEN0753         CDS       T00362                                 

Definition
(GenBank) putative Adenine specific DNA methylase
  KO
K07316  
adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
pen  Pseudomonas entomophila
Brite
Enzymes [BR:pen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     PSEEN0753
Prokaryotic defense system [BR:pen02048]
 Restriction and modification system (R-M system)
  Type III R-M system
   PSEEN0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
782281..783798
Genome map
AA seq 505 aa AA seqDB search
MPLLSWFNRDADLTRAALAPYRLLMPNADLSHGEADSPNMLIQGDNLDALKALLPYYAGQ
VKCVFIDPPYNTKSAFEQYDDNLEHSQWLSMMYPRLELIRELLAPDGSLWVTLDDNEAHY
FKVICDEIFGRPNFIASVIWQKIYSPKNSARHFSVDHDYIFVYAKNAEKWVPNPMPRTEK
QDKAYRNPDNDPRGPWKAGDLSARNYYGAGVYPITTPSGRVISGPPNGMYWRVSEDKLRQ
LDEDNRIWWGKDGGNVPAIKRFLSEVKQGRVPQTFWPYEEVGHTQDAKKEVVAIFGDENF
ATPKPEALMKRILEVATNPGDLVLDSFLGSGTTIAVAHKMGRQWIGIEVGAHAESHCQPR
LARVVDGEQGGVSKSLNWTGGGGFRYYTLGVPVFDESGHIRDGISFEQLAAHVWFAETGT
ARSAHADKSSLLGIHLGTAYYLLFNGILGDLTNTGGNVLTKRVYRALPEFDGQKVVYGEA
CALAPELLQELKITFRQTPYDIRAR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttctttcttggttcaaccgtgacgctgacctcacgcgagccgctctggctcca
tatcgcctgctgatgcccaatgctgacctttcgcatggcgaggctgactcccccaacatg
ctcattcagggcgacaacctcgatgctttgaaagctctgctgccttactacgcagggcag
gtgaaatgtgtcttcatcgacccaccctacaacactaagtccgctttcgagcagtatgac
gacaaccttgagcactctcagtggctgtcgatgatgtatccacgattggagctgatacgt
gagctgctggccccggatggctccctctgggtcaccttggatgacaatgaggcgcattac
ttcaaggtgatctgcgacgagatttttggaaggcccaattttatcgcctccgtcatctgg
cagaaaatctactccccgaagaattcggctcgtcatttttcggtcgatcacgactacatt
tttgtttacgccaaaaacgctgagaaatgggttcccaacccgatgcctcggactgaaaaa
caggacaaagcctatcggaaccccgacaacgatccaagggggccgtggaaggcaggggat
ctgtcagcacgcaactattacggtgctggtgtataccctattacaaccccttcgggtcgt
gtcatttccggcccacctaacggcatgtactggcgtgtgtccgaggacaagcttcgtcaa
ttggatgaggacaatcgaatctggtggggcaaagatggcggtaatgtgccggctatcaaa
cgcttcctctctgaggtgaagcaaggccgagtgcctcagaccttctggccttatgaggaa
gtgggtcatacgcaggatgcgaagaaagaggtagttgcgatatttggtgacgagaatttc
gctactcccaagccggaagcgctgatgaagcgcattcttgaagtggctactaatcctgga
gatcttgtattagacagcttccttgggtcgggaacgaccattgcggtagctcacaagatg
gggcggcagtggatagggatcgaagtaggtgcccacgccgagagccattgtcagcctcgt
ctagcgagagtcgtggacggtgagcagggtggtgtgtccaaaagcttgaattggaccggc
ggtggcgggttcaggtattacacgctcggtgttcctgtattcgatgaatctggtcacatc
cgtgatggtatttcttttgaacagctcgccgctcacgtctggtttgctgaaacgggcacg
gccagatccgcacacgctgacaagtcgtcgcttttgggcatccacctcggtactgcttac
tatctgctttttaatgggattctcggtgatttgacgaatactggtgggaatgttttaaca
aagagggtttacagggcactgcctgaatttgacgggcagaaggtggtttatggcgaggcc
tgtgcgctggctcctgaactgctgcaggaattaaaaattaccttccgccaaacaccttac
gacattagggcacgttga

DBGET integrated database retrieval system