KEGG   Pseudomonas entomophila: PSEEN0790Help
Entry
PSEEN0790         CDS       T00362                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pen  Pseudomonas entomophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEEN0790 (tpiA)
   01230 Biosynthesis of amino acids
    PSEEN0790 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN0790 (tpiA)
   00051 Fructose and mannose metabolism
    PSEEN0790 (tpiA)
   00562 Inositol phosphate metabolism
    PSEEN0790 (tpiA)
Enzymes [BR:pen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSEEN0790 (tpiA)
Exosome [BR:pen04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSEEN0790 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSEEN0790 (tpiA)
  Exosomal proteins of melanoma cells
   PSEEN0790 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821116..821871
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVVELTQGLGNMSLPSGVEVAVFPPSLFVTQVIDGLEGKGINV
GAQNSAVQPEQGALTGEVAPSQLAEVGCKYVLVGHSERRQIIGESDEVLNQKFAAAQKSG
LTPVLCIGETLAEREAGETLKVVGRQLSSVIDAFGIKAFANAVIAYEPVWAIGTGLTASP
QQAQDVHAAIRKQLAAMDAEVAANVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccatggtagctggtaactggaagatgcacggtacccgcgccagcgtcgta
gagctgactcagggcttgggcaatatgtccttgcccagcggtgtggaagtcgcggtgttt
ccgccttcgctgtttgtcactcaggtgattgatggcctggaaggcaagggaatcaacgta
ggcgcacagaattctgctgtacagcctgaacaaggcgcgctgaccggtgaagttgctccg
agtcagttggctgaagtcggttgcaagtatgttctggtcgggcactccgagcgtcgccag
attattggtgaaagcgacgaagtgctgaatcagaagtttgcagcggctcagaaaagtggt
ttgacgccggtgctctgtataggggaaactctcgcagagcgcgaggcaggcgagacgctc
aaagttgtagggcgtcaactaagcagtgttatcgacgcgttcggtatcaaagcttttgcc
aatgcagtaattgcctatgagcctgtttgggccatcggtactggtttgacggcctcgcca
cagcaagcccaggatgtgcatgcagccatccgcaagcagttggcggcgatggacgccgaa
gttgcagctaatgtgcaacttctctacggcggcagcgtgaaggcggccaatgcggctgaa
ctgttcggcatgccggatatcgatggggggctcattggtggagcgtccctgaacgcagac
gaattcggtgcaatttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system