KEGG   Pseudomonas entomophila: PSEEN1369Help
Entry
PSEEN1369         CDS       T00362                                 

Gene name
purN
Definition
(GenBank) phosphoribosylglycinamide formyltransferase 1
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
pen  Pseudomonas entomophila
Pathway
pen00230  Purine metabolism
pen00670  One carbon pool by folate
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01130  Biosynthesis of antibiotics
Module
pen_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSEEN1369 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PSEEN1369 (purN)
Enzymes [BR:pen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     PSEEN1369 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: CAK14246
UniProt: Q1IDL3
Position
complement(1430392..1431045)
Genome map
AA seq 217 aa AA seqDB search
MPGKTCNVVVLLSGSGSNLQALIDSTSASDSPARIRAVISNRADAYGLERAKAAGIDTAV
LEHTGFDGREAFDTALMALIDGFAPDLVVLAGFMRILSGGFVRHYQGRLLNIHPSLLPLY
KGLHTHQRALEAGDREHGCSVHFVTEELDGGPLVVQAVVPVVAGDTPQTLAQRVHVQEHL
IYPLAVRWFAEGRLRLGEQGALLDGQPLAASGHLIRN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcaagacctgtaacgtggtggtgttgctgtcgggttccggcagcaacctgcag
gcgctgatcgacagtaccagcgccagtgacagcccggcccgcatccgcgcggtgatctcc
aaccgcgccgatgcctacggcctcgaacgcgccaaggccgccggtatcgacacggccgtg
ctcgaacacaccggcttcgacggccgcgaggccttcgacacggcgctgatggcgctgatc
gacggcttcgcgcccgacctggtggtgctggccggcttcatgcgcattctcagcggcggt
ttcgtgcgccactatcaaggccgcctgctcaacatacatccgtcattgctgccgctgtac
aaaggcctgcacacccaccagcgcgcgctggaggctggcgaccgggaacatggctgcagc
gtgcacttcgtcaccgaggaactcgatggcgggcctctggtcgtacaggctgtggttccg
gtggttgcgggcgacacgccgcagacgctggcccagcgggtacatgtgcaggaacacctg
atctacccgctggcggtgcgctggttcgccgaaggacgcttgcgtctgggcgaacagggt
gcattactggatggccagccgctggcggccagcggtcacttgattcgaaattag

DBGET integrated database retrieval system