KEGG   Pseudomonas entomophila: PSEEN1392Help
Entry
PSEEN1392         CDS       T00362                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pen  Pseudomonas entomophila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSEEN1392
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSEEN1392
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSEEN1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452816..1453367
Genome map
AA seq 183 aa AA seqDB search
MRACWLTIPVLALMAATSSWAADCPALLQGSLPELRGKEQIDLCERFAGKPLVVINTASY
CGFAPQFEGLEATYKDYHGKGLEMLGVPSNDFKQEDADSDKTAKVCYANYGVTFTMTKAQ
PVRGKDAIPLFVELARQSSAPKWNFYKYVVDRRGKVIGSFSSLTKPDDPAFRAAIEKAIA
SPL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcatgctggctgacgatacccgtgctggccctgatggccgccacctcgagctgg
gcggcggattgcccggcactgctccagggcagcctgccagagttgcggggcaaggagcag
atcgacttgtgcgagcgctttgccggcaagccgctggtggtgatcaacactgccagctat
tgcgggtttgccccgcagttcgaggggctcgaggcgacgtacaaggattaccacggcaaa
gggctggaaatgctcggggtgccgtccaacgatttcaagcaggaagatgccgatagcgac
aagacggccaaggtctgttacgccaattatggtgtgacctttaccatgaccaaggcgcag
ccggtgcggggtaaggatgcgattccgttgttcgtcgagttggctcggcagagcagtgcg
cctaagtggaatttctacaagtatgtggtggatcggcgggggaaggtgattgggagtttt
tccagtttgaccaagccggatgatccggcgttcagggcggccatcgagaaggcgatcgct
tcgccgctttga

DBGET integrated database retrieval system