KEGG   Pseudomonas entomophila: PSEEN1469Help
Entry
PSEEN1469         CDS       T00362                                 

Definition
asparagine synthetase AsnB (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pen  Pseudomonas entomophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSEEN1469
Enzymes [BR:pen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PSEEN1469
Peptidases [BR:pen01002]
 Cysteine Peptidases
  Family C44
   PSEEN1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1537538..1539325)
Genome map
AA seq 595 aa AA seqDB search
MCGLAGELRFTPLNQAPRPADLAAVERITHHLAPRGPDAWGFHSQGPIALGHRRLKIMDL
SDGSAQPMVDTPLGLSLAFNGAIYNFPELRQELQALGYHFHSDGDTEVLLKGYHAWGAAL
LPKLNGMFALAIWERDNQRLFLARDRLGVKPLYLSRNGERLRFASTLPALLKGGDIDPLI
DPVALNHYLNFHAVVPAPRTLLANVQKLEPGTWMRIDRHGEVERQAWWQLHYGPNPEERE
LDLEGWTTQVLDTTRDAVAIRQRAAVDVGVLLSGGVDSSLLVGLLREAGVDDLSTFSIGF
EDAGGERGDEFQYSDLIARHYGTRHHQLRIDEREIIEQLPAAFRAMSEPMVSHDCIAFYL
LSREVAKHCKGVQSGQGADELFAGYHWYPQVDGAEDAFGAYRAAFFDRSHEEYRETVQPP
WLLESDAAGDFVREHFARPGAPDALDKALRLDSTVMLVDDPVKRVDNMTMAWGLEARTPF
LDYRLVELSARIPARFKLPDGGKQVLKQAARRVIPHEVIDRKKGYFPVPGLKHLQGATLD
WVRELLTDPSQDRGLFNPAMLDRLLSNPHGQLTPLRGSKLWQLAALNLWLSEQGI
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattagcaggagagttacgtttcacccccctcaaccaagccccacgcccggcg
gacctcgccgccgtggagcgcatcacccaccacctggcaccccgcgggcccgacgcctgg
ggcttccatagccagggcccgattgccctcggccaccgtcgcctgaagatcatggacctg
tccgatggctcggcccagcccatggtcgacacgcccctggggctgtcgctggccttcaac
ggcgccatctacaacttccccgaactgcgtcaggagcttcaggccctgggctatcacttc
cactcggacggcgacaccgaagtgctgctcaagggctaccatgcctggggcgcggcgctg
ctgcccaagctcaacggcatgtttgccctggccatctgggaacgcgacaaccagcgcctg
ttcctggcccgcgaccgcctcggcgtcaagccgctgtacctgtcgcgcaacggtgaacgc
ctgcgcttcgcctcgaccctgccagcgctgctcaagggcggcgatatcgacccgctgatc
gacccggtggcgctcaaccactacctcaacttccatgcggtggtgcccgcgccgcgcacc
ctgctggccaatgtgcaaaagctcgaacccggcacctggatgcgtatcgaccgccacggt
gaagtcgaacgccaggcctggtggcaattgcactacggcccgaacccggaggagcgcgaa
ctcgacctcgaaggctggaccacccaggtgctcgataccacacgcgacgccgtggcgatt
cgccaacgtgcggcggtggatgtcggcgtgctgttgtccggtggcgtcgactccagcctg
ctcgtcggcctgctgcgagaggccggggtggacgacctgtcgaccttttccatcggtttc
gaggatgccggcggtgaacgcggcgacgagttccagtactccgatctgatcgcacgccac
tacggcacccgccatcatcaactgcgcatcgacgaacgcgagatcatcgaacagttgcca
gcagcgtttcgcgccatgagcgaaccgatggtcagccatgactgcatcgctttctacctg
ctctcgcgggaagtcgcgaagcactgcaagggcgtgcagagcggccagggcgccgacgag
ctgttcgccggctatcactggtacccgcaggtggacggcgccgaagacgccttcggcgcc
taccgcgccgccttcttcgaccgtagccacgaggaataccgcgagaccgtgcagcccccc
tggctgctggagagcgatgccgcaggtgacttcgtccgcgagcacttcgcccgcccaggc
gcccccgatgcgctggacaaggccctgcgcctggacagcacggtgatgctggtggacgac
ccggtcaagcgcgtggacaacatgaccatggcctggggcctggaggcgcgcacgcccttc
ctcgactaccgcctggtcgaattgtcggcacgcatcccggcacgcttcaagctgcccgat
ggtggcaagcaggtactcaagcaggcagcgcggcgggtcatcccccatgaagtgatcgac
cgcaagaaaggctacttcccagtccccggcctcaagcacctgcaaggcgcgacgctggac
tgggtgcgcgaactgctgaccgaccccagccaggaccgtggcctgttcaatccggcgatg
cttgatcgcctgctgagcaacccgcacggccagctcaccccgctgcgcggttccaagctg
tggcagctggccgccttgaacctgtggctcagcgagcaaggaatctga

DBGET integrated database retrieval system