KEGG   Pseudomonas entomophila: PSEEN1510Help
Entry
PSEEN1510         CDS       T00362                                 

Gene name
pyrF
Definition
orotidine 5'-phosphate decarboxylase (EC:4.1.1.23)
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
pen  Pseudomonas entomophila
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pen00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1585407..1586108
Genome map
AA seq 233 aa AA seqDB search
MSACQTPLIVALDFPTRDAALKLADQLDPALCRVKVGKELFTSSASGIVETLCAKGFEVF
LDLKFHDIPNTTAMAVKAAAEMGVWMVNVHCSGGLRMMSACREELAKRSGPQPLLIGVTV
LTSMEREDLAGIGLDVDPQVQVLRLAALAQKAGMDGLVCSALEAPALKAAHPSLQLVTPG
IRPAGSAQDDQRRILTPRQALDAGSDYLVIGRPISQAADPAKALAAVVAEIRG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctgccagacgcccctgatcgtcgccctggatttccctacccgtgacgccgcc
ctgaagctggccgaccagctcgatcctgcgctgtgccgggtgaaggttggcaaggagctg
ttcaccagtagcgcatccggaatcgtcgagactctctgcgccaagggttttgaagtgttc
ctcgacctcaagttccacgatatccccaacaccacggccatggcggtgaaggcggcggcg
gagatgggcgtgtggatggtcaacgttcactgctccggcggcctgcgcatgatgtcggct
tgccgcgaggagctggccaagcgtagtggtccgcaaccgctgctgatcggcgtgaccgtg
ctgaccagcatggagcgcgaggatctggccggtattggcctggatgtcgacccgcaagtg
caggtcctgcgcctggcggcgctggcacagaaggctggcatggacggtctggtgtgttcg
gcgctggaggctccggcgttgaaggctgcgcatccttcgttgcaactggtcacccccggt
attcgcccggcaggcagtgcccaggacgatcaacggcgtattctgaccccgcgccaggcg
ttggatgccggctccgattacctggtgatcggtcgtccgatcagccaggcggcagacccg
gccaaggctttggctgccgtggtggccgagatccgcggctga

DBGET integrated database retrieval system