KEGG   Pseudomonas entomophila: PSEEN1521Help
Entry
PSEEN1521         CDS       T00362                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pen  Pseudomonas entomophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSEEN1521 (folE)
Enzymes [BR:pen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PSEEN1521 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1596377..1596922)
Genome map
AA seq 181 aa AA seqDB search
MSLEQNYTEILSQLGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNGALFSSDNSE
MVLVRDIELYSMCEHHMLPFIGKAHVAYLPQGKVLGLSKVARIVDMFARRLQIQENLSRQ
IAEAVQQVTGAAGVAVVIEAKHMCMMMRGVEKQNSTMLTSVMLGEFRENASTRSEFLSLI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacagaactacaccgagatcctcagccagctgggcgaggacgtctcccgc
gaaggcctgctcgacacgccgaaacgggctgcgaaggccatgaaatacctttgccgcggt
tatgagcagaccctggaagaagtgaccaacggtgcgctgttcagctccgacaacagcgaa
atggtgctggtccgggacatcgagctgtactcgatgtgcgaacaccacatgctgccgttc
atcggcaaggcccatgtcgcctacctgccccagggcaaggtgctcggcctgtcgaaggtt
gcgcggatcgtcgacatgttcgcccgtcgcctgcagatccaggaaaacctcagccgccag
atcgccgaggccgtccagcaggtgaccggcgccgcgggcgtggccgtggtcatcgaagcc
aagcacatgtgcatgatgatgcgcggcgtcgagaagcagaactcgaccatgctcacctcg
gtgatgctcggcgagttccgcgagaacgcctccacccgcagcgagttcctcagcctgatc
aagtga

DBGET integrated database retrieval system