KEGG   Pseudomonas entomophila: PSEEN1531Help
Entry
PSEEN1531         CDS       T00362                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pen  Pseudomonas entomophila
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pen00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1604359..1604895
Genome map
AA seq 178 aa AA seqDB search
MSILSVFDPSSPELPNKVLTHHDDIVATLAEQGLRFGRWQSGARLRPGSSQAEVLEACRQ
PLDQLMTAHGSAAFAVLSREGGDPGQNDLRDEHVHDCEEVFAVISGRAQVSLRLGGFVYA
VLCEKDDALVIPAAVRRWLDLGDAPFCLALRLFGSEQGMQPRFTGDADARQFPGLDEC
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctcagtgttttcgacccgtccagcccggaactgccgaacaaggtgttgacc
caccacgacgatatcgtcgcgaccctggccgaacagggcctgcgtttcggccgctggcaa
tcgggtgcgcggctgcgtccaggcagcagccaggccgaagtgctggaggcctgccgccag
cccctcgatcaattgatgactgcccacggcagcgcggcattcgccgtgctcagccgcgag
gggggcgatccgggccagaatgatctgcgtgacgagcatgtgcatgactgcgaggaagtg
ttcgcggtgatcagcgggcgcgcccaggtcagcctgcgcctgggcggttttgtctacgcc
gtgttgtgcgagaaggacgacgcactggtgattccagcagcggtacggcgctggctggac
ctgggagatgccccgttctgcctggcgttgcgcctgttcggcagcgagcagggcatgcag
cctcgcttcaccggcgatgccgacgcccggcagttcccggggctcgacgaatgctga

DBGET integrated database retrieval system