KEGG   Pseudomonas entomophila: PSEEN1531Help
Entry
PSEEN1531         CDS       T00362                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pen  Pseudomonas entomophila
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PSEEN1531
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PSEEN1531
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PSEEN1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1604359..1604895
Genome map
AA seq 178 aa AA seqDB search
MSILSVFDPSSPELPNKVLTHHDDIVATLAEQGLRFGRWQSGARLRPGSSQAEVLEACRQ
PLDQLMTAHGSAAFAVLSREGGDPGQNDLRDEHVHDCEEVFAVISGRAQVSLRLGGFVYA
VLCEKDDALVIPAAVRRWLDLGDAPFCLALRLFGSEQGMQPRFTGDADARQFPGLDEC
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctcagtgttttcgacccgtccagcccggaactgccgaacaaggtgttgacc
caccacgacgatatcgtcgcgaccctggccgaacagggcctgcgtttcggccgctggcaa
tcgggtgcgcggctgcgtccaggcagcagccaggccgaagtgctggaggcctgccgccag
cccctcgatcaattgatgactgcccacggcagcgcggcattcgccgtgctcagccgcgag
gggggcgatccgggccagaatgatctgcgtgacgagcatgtgcatgactgcgaggaagtg
ttcgcggtgatcagcgggcgcgcccaggtcagcctgcgcctgggcggttttgtctacgcc
gtgttgtgcgagaaggacgacgcactggtgattccagcagcggtacggcgctggctggac
ctgggagatgccccgttctgcctggcgttgcgcctgttcggcagcgagcagggcatgcag
cctcgcttcaccggcgatgccgacgcccggcagttcccggggctcgacgaatgctga

DBGET integrated database retrieval system