KEGG   Pseudomonas entomophila: PSEEN1550Help
Entry
PSEEN1550         CDS       T00362                                 

Gene name
aprA
Definition
alkaline metalloprotease AprA (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
pen  Pseudomonas entomophila
Brite
Enzymes [BR:pen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     PSEEN1550 (aprA)
Peptidases [BR:pen01002]
 Metallo Peptidases
  Family M10
   PSEEN1550 (aprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1619738..1621195
Genome map
AA seq 485 aa AA seqDB search
MSKVKESAIVSATSALQPQGPSSSYGLINSFAHQYDRGGANVNGKPSYTVDQAANYLLRD
GAAWKDLNKDGTISLSYTFLTKAPSDFYSRGLGTFSQFSDLQKGQAKLAMQSWADVAKVT
FTEAASGGDGHMTFGNFSASNGGAAFAYLPFDMPGSHKGESWYLINSSYQVNTTPGTGNY
GRQTLTHEIGHVLGLSHPGDYNAGEGNPTYRDATYAQDTRGYSVMSYWSESNTGQNFVKA
GGQYYASAPLMDDIAAIQKLYGANYATRSGDTVYGFNSNADRDFYSATSSSSKLVFSVWD
GGGNDTFDFSGFTQNQKINLNETSFSDVGGMIGNVSIAKGVTIENAFGGSGNDLLIGNAL
ANVLKGGAGNDIIYGGGGADQLWGGTGADTFVFGAISDSTKAAPDRIMDFTSGQDKIDLS
AISAFAVNKLPLQFVNAFTGHAGEAVLSYDQGTNLGSLSIDFTGNSSADFLVTTVGQAAV
TDIVV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagtcaaagaaagcgctattgtttcggctacgtccgcactgcaaccgcagggg
ccgagctcttcctatggtctgatcaatagctttgcccaccagtacgatcgcggtggcgcg
aacgtcaatggcaaaccttcgtacacggtcgaccaggctgccaactatctgctgcgtgac
ggcgccgcctggaaagacctgaacaaggacggcaccatcagcctctcctacaccttcctg
accaaggcaccttctgacttctacagccgtggactgggcacgttcagccagttcagcgac
ctgcagaaaggccaggccaaactcgccatgcagtcctgggcggacgtggccaaggtgacc
tttacggaagctgcgtcgggcggcgacggtcacatgaccttcggcaacttcagcgccagc
aacggtggggcggcgttcgcctacctgccgttcgacatgccgggttcgcacaagggtgaa
tcctggtacctgatcaacagcagctaccaggtcaacaccaccccaggcaccggcaactac
gggcgccagaccctgacccacgagatcggccatgtactcggtctgtcccaccccggcgac
tacaacgccggcgagggcaacccgacctacagggacgccacgtacgctcaggacacccgt
ggctacagcgtgatgagctactggagcgagagcaataccggccagaacttcgtcaaggcc
ggtggccagtactacgcttcggcgccgctcatggacgatatcgcggccatccagaagctg
tacggtgccaactacgcgacgcgctccggcgacaccgtgtatggcttcaactccaacgcg
gatcgtgacttctactcggccacttcgtcttcgtcgaagctggtcttctcggtgtgggat
ggtggcggcaacgacaccttcgacttctctgggttcacccagaaccagaagatcaacctc
aatgagacctcgttctccgatgttggtggcatgatcggtaacgtgtccatcgccaagggc
gtgaccatcgaaaacgcctttggtggttcgggcaacgacctgctgatcggcaacgcgctg
gctaacgtgctcaagggtggtgccggcaacgacatcatctacggcggtggcggtgccgac
caactgtggggcggcactggcgcggacaccttcgtgtttggcgctatcagcgattccacc
aaggccgcgccggaccggatcatggacttcacctcgggtcaggacaagatcgacctgtcg
gcgatttccgcgttcgccgtgaacaagctgccgctgcagttcgtcaacgccttcaccggc
catgccggcgaggcggtgctgagctacgaccagggtaccaacctgggcagcctgtccatc
gacttcaccggaaacagctcggctgacttcctggtgaccaccgttggccaggccgctgtc
accgacatcgtggtctga

DBGET integrated database retrieval system