KEGG   Pseudomonas entomophila: PSEEN1585Help
Entry
PSEEN1585         CDS       T00362                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pen  Pseudomonas entomophila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pen00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pen00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1654668..1655156
Genome map
AA seq 162 aa AA seqDB search
MADALLDIPCVTLSGEQKVLGDYAGKALLVVNTASQCGFTPQYKGLERLWQDYGQRGLVV
LGFPCNQFGKQEPGDAKEIAQFCELNFGVSFPLFRKIEVNGPGAHPLFVELKRRAPGVLG
TQKIKWNFTKFLVDPASGKVTRFGSTTKPEALKSSIEALLNR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgcactgctggacattccctgcgtcaccctttccggtgagcagaaagtactg
ggcgactacgccggcaaggcgttgctggtggtcaacaccgccagccagtgcggcttcacc
ccgcagtacaaggggctggagcgcctgtggcaggactacggccagcgtggcctggtggtg
ctgggcttcccttgcaaccagttcggcaagcaggagccgggcgatgcgaaggagatcgcg
cagttctgcgagctcaatttcggcgtgagcttcccgctgtttcgcaagatcgaggtcaac
ggccccggcgcccacccgctgttcgtcgagctcaagcggcgcgcgccgggcgtgctgggt
acgcagaagatcaagtggaatttcaccaagttcctggtcgatcctgctagcggcaaggtc
acccgtttcggctcgaccaccaagcccgaggcgctgaagtcgtccatcgaggcactgctc
aaccgctga

DBGET integrated database retrieval system