KEGG   Pseudomonas entomophila: PSEEN1790Help
Entry
PSEEN1790         CDS       T00362                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pen  Pseudomonas entomophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pen03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1870883..1871485
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDALRILPGVGQKTAQRMALQLLERDRSGGTRLAQALSQAMEGVGHCRQC
RTLTEQELCPQCADPRRDDTQLCVVEGPVDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFSEVILATNPTVEGEATAHYIAQLLAEKGLTATRIAHGVPLGGEL
ELVDGGTLAHAFAGRRPIAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgatccgccaactgatcgacgccctgcgcattctgcccggtgtc
ggccagaaaaccgcccagcgcatggccctgcagctgctggagcgcgaccgcagcggcggc
acgcgcctggcccaggccctgagccaggccatggaaggcgtcggtcactgccgccaatgc
cgtacgctgaccgagcaggaactgtgcccgcagtgcgccgacccacgccgtgacgacacg
caactgtgcgtggtcgaggggccagtggacgtctatgcggtggagcagactggctatcgc
ggtcgttacttcgtgctcaagggccacctgtcgccgttggacggcctggggccggaggct
atcggtattccccagctgatggccaggatcgaagagcagggcaccttcagcgaggtgatc
ctggctaccaacccaacggtggaaggggaggcgaccgcccactacattgcccaactgctg
gccgagaagggcctgaccgctacgcgcatcgcccatggcgtgccgttgggtggggagctg
gaactggtggatggcgggacgctggcccatgcgtttgccgggcgccggccgatagcgttg
tga

DBGET integrated database retrieval system