KEGG   Pseudomonas entomophila: PSEEN1790Help
Entry
PSEEN1790         CDS       T00362                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pen  Pseudomonas entomophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pen00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSEEN1790 (recR)
DNA repair and recombination proteins [BR:pen03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSEEN1790 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1870883..1871485
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDALRILPGVGQKTAQRMALQLLERDRSGGTRLAQALSQAMEGVGHCRQC
RTLTEQELCPQCADPRRDDTQLCVVEGPVDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFSEVILATNPTVEGEATAHYIAQLLAEKGLTATRIAHGVPLGGEL
ELVDGGTLAHAFAGRRPIAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgatccgccaactgatcgacgccctgcgcattctgcccggtgtc
ggccagaaaaccgcccagcgcatggccctgcagctgctggagcgcgaccgcagcggcggc
acgcgcctggcccaggccctgagccaggccatggaaggcgtcggtcactgccgccaatgc
cgtacgctgaccgagcaggaactgtgcccgcagtgcgccgacccacgccgtgacgacacg
caactgtgcgtggtcgaggggccagtggacgtctatgcggtggagcagactggctatcgc
ggtcgttacttcgtgctcaagggccacctgtcgccgttggacggcctggggccggaggct
atcggtattccccagctgatggccaggatcgaagagcagggcaccttcagcgaggtgatc
ctggctaccaacccaacggtggaaggggaggcgaccgcccactacattgcccaactgctg
gccgagaagggcctgaccgctacgcgcatcgcccatggcgtgccgttgggtggggagctg
gaactggtggatggcgggacgctggcccatgcgtttgccgggcgccggccgatagcgttg
tga

DBGET integrated database retrieval system