KEGG   Pseudomonas entomophila: PSEEN1886Help
Entry
PSEEN1886         CDS       T00362                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pen  Pseudomonas entomophila
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSEEN1886
Enzymes [BR:pen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSEEN1886
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSEEN1886
Lipid biosynthesis proteins [BR:pen01004]
 Fatty acid synthase
  Component type
   PSEEN1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976701..1977306
Genome map
AA seq 201 aa AA seqDB search
MRMWWLSAGLALCCLAQGAVAGTVLVVGDSISAGFGLDTREGWVELLQKRLKDEGFDDQV
VNASISGDTSAGGRARLPALLVAHKPDLVVLELGGNDGLRGQPPQQLQQNLALMIDRARQ
AGARVVLLGMRLPPNYGVRYTTAFAQVYEQLASDKQVPLVPFFLEGVGGVPAMMQADGIH
PAPVAQQRLLENAWPTIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgtggtggttgagtgccgggcttgccctgtgttgcctggcccagggcgcggtg
gccggaaccgtgctggtcgtcggcgatagtatcagcgccggttttggcctggatacccgc
gaggggtgggtcgaactgttgcaaaagcgcctgaaggacgagggtttcgacgaccaggtg
gtcaatgcctcgatcagtggcgacaccagcgcgggtggtcgggcgcggctgccggcgctg
cttgtggcgcacaagccggacctggtggtgctggaactggggggcaatgatggcctgcgc
gggcagccgccacagcaattgcaacaaaatcttgccctgatgatcgaccgtgcccgccag
gccggcgccagggtggtgctgttgggcatgcgcctgccgcccaactacggcgtgcgctac
accaccgccttcgcccaggtgtatgaacagctggccagcgacaagcaggtgccgttggta
ccgtttttcctggaaggtgtgggcggggtgccggcgatgatgcaggccgatggtattcac
cctgcgccggttgcccagcagcgcttgctggaaaatgcctggccgacgataaaacccttg
ttgtga

DBGET integrated database retrieval system