KEGG   Pseudomonas entomophila: PSEEN2052Help
Entry
PSEEN2052         CDS       T00362                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pen  Pseudomonas entomophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSEEN2052
Enzymes [BR:pen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PSEEN2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2149353..2151422)
Genome map
AA seq 689 aa AA seqDB search
MSEQPLHRLAAQMGLARDWVDANNRPQQVSDDVLRQVLQGLGHPAHDRAAIDASLLAVAQ
AQDSEHLPPLITVDSGQPLDLQRYFSAGSTVRCTLEDGSQQTLQLDAQARLPGELPLGYH
QLDIDGRSFTVAVAPLRCHALQDRVEQTPPRCWGLAVQLYSLRRPGDGGYGDCLALEQLA
RNAAERGAEALAISPIHALSVIDQQHYSPYSPSSRLLLNTLYASPAALLGERAVRMAIEA
CGLEQTLEDLEQRPLVDWPRAADARLRLLEALYQDFSQGNHPLREDFDRFRASGGEKLEH
HCRFEVLQAHAMEHGLGSDWRTWPAAWHDPYHPEVEAFAHAYPARVEFHAFCQWLTERSL
QRAQDAARGNGMAIGLIADLAVGADGAGSQAWSRQDELLADLKVGAPPDILNRAGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLVPRGAKPSEGAYLEYPL
DDLLRLLALESVRHQAIILGEDLGTVPEGLRERLADKAVLGMRVLPFEQAAPGHFTPILD
WPDNALATTGTHDLAPLAGWLAGRDIDWSHRLKLIEAAAELHWRHARALERDGLRRTLEQ
NYGPLADDGALIDAAIRYVGHTRAPLVLVPLEDLLGCDEQPNLPGTTEGHPNWRRRFRTP
VRDLLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacagcccctccatcgcctggctgcccagatgggcctggcccgcgactgggtc
gatgccaacaaccgcccgcagcaggtcagcgatgacgtgttgcgccaggtcttgcaaggc
ctcgggcacccggcccatgaccgcgcggccatcgacgccagcctgcttgcggtcgcgcag
gcgcaggacagcgagcacttgccacctttgatcaccgtcgacagtggccagccactcgac
ctgcaacgctacttcagtgccggcagcacggtgcgctgcaccctggaagacggcagccag
caaacgctgcaactggacgcccaggcccgcctgccgggcgaactgccgctgggttaccac
caactggacatcgacggccgaagcttcaccgtggcggtggcgcccctgcgctgccatgcc
ctgcaagaccgcgtggagcaaacaccgccccgctgctggggcctggcggtgcagttgtac
agcctgcgtcgccccggcgatggcggctacggcgactgcctggccctggagcaattggcg
cgcaacgccgccgagcgcggcgccgaagccttggcgatcagcccgatccacgcgttgtcg
gtgatcgaccagcagcactacagcccctactcgccctccagccgcctgctgctcaacacc
ctgtacgccagccccgccgccctgctgggcgagcgtgccgtacgcatggcgatcgaagcc
tgcggcctggagcagacactcgaagacctggagcagcgcccgctggtcgactggccacgg
gccgccgatgcccgcctgcgcttgctcgaagccctctaccaggacttcagccagggcaat
catccactgcgcgaagatttcgaccggttccgcgccagtggcggtgaaaagctcgagcac
cactgccgcttcgaggtgctgcaggcccatgccatggaacacggcctggggtccgactgg
cgcacctggccagcggcctggcacgacccctaccacccggaagtcgaggcctttgcccat
gcctaccccgcccgcgtggagttccatgccttctgccagtggctgaccgaacgcagcctg
caacgggcccaggacgccgcgcgcggcaatggcatggccatcggcctgatcgccgacctg
gcggtgggcgccgacggtgccggcagccaggcctggagccgccaggatgagctgctggcc
gacctcaaggtcggcgcgcccccggacatcctcaaccgcgccgggcaggactggggcatc
tgcgccttctcgcccgaaggcctcaagcgcaacggctaccgcgccttcatcgagatgctg
cgggccaacctggcccatgccggcggcctgcgcatcgaccatgtgatgggcctgcgccgg
ctgtggctggtgccccgtggcgccaagcccagcgagggcgcctacctggagtacccgctg
gacgacctgctgcgcctgctggccctggagtcggtacgccaccaggcaatcatcctcggt
gaagaccttggcaccgtccccgaaggcctgcgtgaacgcctggccgacaaggccgtgctg
ggcatgcgcgtgctgcccttcgagcaggccgcgcccgggcatttcacaccgatcctcgac
tggcccgacaacgccctggccaccaccggcacccatgaccttgcgcccctggccggctgg
ctggcgggccgcgatatcgactggagccaccgcctgaagctgatcgaggccgccgcagaa
ctgcactggcggcatgcgcgggcactggagcgcgacggcctgcgccgcaccctggagcag
aactacggccccctggcggacgacggcgcactgatcgacgccgcgatacgctacgtcggc
catacccgcgccccgctggtgctggtgcccctggaagacctgctgggctgcgacgaacaa
cccaacctgcccggcaccaccgagggccaccccaactggcgacgacgcttcaggacgccg
gtgcgcgacctgctcgacgacgaggacgccgcccgccgcctggagctgctggcacaggcc
cgcgagcaggcctgggagcgtgatcgatga

DBGET integrated database retrieval system