KEGG   Pseudomonas entomophila: PSEEN2059Help
Entry
PSEEN2059         CDS       T00362                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pen  Pseudomonas entomophila
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PSEEN2059
Enzymes [BR:pen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PSEEN2059
    3.5.1.-  
     PSEEN2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2159923..2160573)
Genome map
AA seq 216 aa AA seqDB search
MKIASFDVDAQNGFTANAPQELPVPGGEQIAPALNLMARRATLRLGSKDAHPANAAWVVA
EASQMLQPLALANADLTWVSHCVPGTPGFELLPGLPAPVDYDYFVWKGVELDLHPYGACY
HDLAERRSTGVIEYLKVQQVQAIIVGGLALDYCVRTTALQLRRAGFEVLLYLPACRALSA
DGANDACAAMSAAGIHLCADEAALDTRLTLLQEARP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgccagtttcgatgtcgacgcgcagaacggtttcaccgccaacgccccgcag
gaactgccggtgcctggcggcgagcagatcgcccccgcgctcaacctcatggcccgccgc
gccaccttgcgcctgggcagcaaggacgcccacccggccaacgccgcctgggtcgtggcc
gaagcgagccagatgctgcagcccctggcgctggccaacgccgacctgacctgggtgagc
cactgcgtccccggcaccccgggcttcgaactgctacccggcctgcccgccccggtcgac
tacgactatttcgtctggaaaggcgtcgagctcgacctgcacccctacggcgcctgctac
cacgacctggccgagcgccgctccaccggcgtgatcgaatacctcaaggtgcaacaggtg
caggcgatcatcgtcggcggcctggccctggactactgcgtgcgcaccaccgccctgcaa
ctgcgccgggccggcttcgaggtgctgctgtacctcccggcctgccgcgccctgagcgcc
gacggtgccaacgacgcctgcgccgcgatgagcgccgccggcatccacctctgcgccgac
gaagccgcgctcgacacccgactcaccctgctgcaggaagcccgcccatga

DBGET integrated database retrieval system