KEGG   Pseudomonas entomophila: PSEEN2155Help
Entry
PSEEN2155         CDS       T00362                                 

Definition
unspecific monooxygenase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
pen  Pseudomonas entomophila
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PSEEN2155
  Amino acid metabolism
   00380 Tryptophan metabolism
    PSEEN2155
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PSEEN2155
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PSEEN2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266275..2267684)
Genome map
AA seq 469 aa AA seqDB search
MEALDNRSLHTHGGHPFTMVAATPLQSRLHRLLGVLAAPWLLPRRWRNSRALRDRTRPYH
YIGKLARHADGSWRRYLRLPTFAGDYSVLIGVEEIRGLMQHPRMGQGELVGDGRQFLVIA
DALGRMRLSKERQDAKQKRNIIAHLVSGPERFIQTMRQLSEQRVRRWWQGAPTLLVNAEL
SEFTAEVYLRSVMDLQGPVEGVGQMLEEQVDLLGQAFAYHKPAHFNRRFDELKRQLVARI
GNDPGLLNSTDYTHRLNAYIDQHYQSLQDEAFATGLNGAVLAGYVAPFPSFLALVDELGR
HPRYRQALRQELLTKGDDHAAYIRRDDTLLHACVHEVLRLHPAQPFLFRAASRDLMVNGH
FVRQGSELVADIYHVLRLPELWGEDADAFRPERFQEAPERYRQPFLAYSSGPNNCTGQMF
SRYSLKVLLAEMVRAGDWESTDEPLEHHFHFALAMSRPVRIRLKEHHHG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgctcgacaatcgatcactgcacacccacggcggccaccccttcacgatggtc
gccgccacccccctgcaaagccgcctgcaccgcctgctcggcgtgctggccgccccctgg
ctgttgccacggcgctggcgcaactcgcgggcgctgcgcgaccgcacccgcccctaccac
tacatcggcaagctggccaggcacgccgacggcagctggcggcgctacctgcgcctgccg
accttcgccggcgactacagcgtgctgatcggcgtcgaggagatccgcgggctgatgcaa
cacccgcgcatgggccagggcgagctggtcggcgacggtcgccagttcctggtcatcgcc
gatgcgctggggcgcatgcgcctgagcaaggagcgccaggacgccaagcagaagcgcaac
atcatcgcccacctggtcagcggcccggaacgtttcatccagaccatgcgccaactcagc
gagcagcgggtgcgtcgctggtggcaaggcgcgccgaccttgctggtcaacgccgaactc
agcgaattcaccgccgaggtctacctgcgctcggtcatggaccttcaggggccggtggaa
ggcgtggggcagatgctcgaggagcaggtggacctgctcgggcaggctttcgcctaccac
aagcccgcgcacttcaaccgtcgcttcgacgagctcaagcgccagttggtggcgcgcatc
ggcaacgatccgggcttgctcaacagcaccgactacacccaccggctcaatgcctacatc
gaccagcactaccagtcgctgcaggacgaggcgttcgccaccgggctcaatggcgcggtg
ctggccggctacgtggcgcctttcccgtcgttcctcgccctggtcgacgagctcggccgt
cacccccgctatcgccaggccctgcgccaggagctgctgacgaagggcgatgaccacgcc
gcctacatccgccgcgacgacacgctgctgcacgcctgcgtccacgaagtgctgcgcctg
catccggcacagcccttcctgttccgcgcggcgagccgcgacctgatggtcaacggccat
ttcgtccgccagggcagcgagttggtggccgacatctaccacgtgctgcgcctgcccgag
ctgtggggcgaggatgccgacgccttccgccccgagcgcttccaggaagccccggagcgc
taccgccagccgttcctcgcctactccagcgggccgaacaactgcaccggccagatgttc
tcgcgctactcgctcaaggtgctgctggccgaaatggtgcgcgccggcgactgggaatcc
accgatgagcccctcgaacatcacttccacttcgccctggccatgagccgcccggtgcgg
atccgcctgaaggagcaccatcatggctga

DBGET integrated database retrieval system