KEGG   Pseudomonas entomophila: PSEEN2155Help
Entry
PSEEN2155         CDS       T00362                                 

Definition
unspecific monooxygenase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
pen  Pseudomonas entomophila
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pen00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pen00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pen00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266275..2267684)
Genome map
AA seq 469 aa AA seqDB search
MEALDNRSLHTHGGHPFTMVAATPLQSRLHRLLGVLAAPWLLPRRWRNSRALRDRTRPYH
YIGKLARHADGSWRRYLRLPTFAGDYSVLIGVEEIRGLMQHPRMGQGELVGDGRQFLVIA
DALGRMRLSKERQDAKQKRNIIAHLVSGPERFIQTMRQLSEQRVRRWWQGAPTLLVNAEL
SEFTAEVYLRSVMDLQGPVEGVGQMLEEQVDLLGQAFAYHKPAHFNRRFDELKRQLVARI
GNDPGLLNSTDYTHRLNAYIDQHYQSLQDEAFATGLNGAVLAGYVAPFPSFLALVDELGR
HPRYRQALRQELLTKGDDHAAYIRRDDTLLHACVHEVLRLHPAQPFLFRAASRDLMVNGH
FVRQGSELVADIYHVLRLPELWGEDADAFRPERFQEAPERYRQPFLAYSSGPNNCTGQMF
SRYSLKVLLAEMVRAGDWESTDEPLEHHFHFALAMSRPVRIRLKEHHHG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgctcgacaatcgatcactgcacacccacggcggccaccccttcacgatggtc
gccgccacccccctgcaaagccgcctgcaccgcctgctcggcgtgctggccgccccctgg
ctgttgccacggcgctggcgcaactcgcgggcgctgcgcgaccgcacccgcccctaccac
tacatcggcaagctggccaggcacgccgacggcagctggcggcgctacctgcgcctgccg
accttcgccggcgactacagcgtgctgatcggcgtcgaggagatccgcgggctgatgcaa
cacccgcgcatgggccagggcgagctggtcggcgacggtcgccagttcctggtcatcgcc
gatgcgctggggcgcatgcgcctgagcaaggagcgccaggacgccaagcagaagcgcaac
atcatcgcccacctggtcagcggcccggaacgtttcatccagaccatgcgccaactcagc
gagcagcgggtgcgtcgctggtggcaaggcgcgccgaccttgctggtcaacgccgaactc
agcgaattcaccgccgaggtctacctgcgctcggtcatggaccttcaggggccggtggaa
ggcgtggggcagatgctcgaggagcaggtggacctgctcgggcaggctttcgcctaccac
aagcccgcgcacttcaaccgtcgcttcgacgagctcaagcgccagttggtggcgcgcatc
ggcaacgatccgggcttgctcaacagcaccgactacacccaccggctcaatgcctacatc
gaccagcactaccagtcgctgcaggacgaggcgttcgccaccgggctcaatggcgcggtg
ctggccggctacgtggcgcctttcccgtcgttcctcgccctggtcgacgagctcggccgt
cacccccgctatcgccaggccctgcgccaggagctgctgacgaagggcgatgaccacgcc
gcctacatccgccgcgacgacacgctgctgcacgcctgcgtccacgaagtgctgcgcctg
catccggcacagcccttcctgttccgcgcggcgagccgcgacctgatggtcaacggccat
ttcgtccgccagggcagcgagttggtggccgacatctaccacgtgctgcgcctgcccgag
ctgtggggcgaggatgccgacgccttccgccccgagcgcttccaggaagccccggagcgc
taccgccagccgttcctcgcctactccagcgggccgaacaactgcaccggccagatgttc
tcgcgctactcgctcaaggtgctgctggccgaaatggtgcgcgccggcgactgggaatcc
accgatgagcccctcgaacatcacttccacttcgccctggccatgagccgcccggtgcgg
atccgcctgaaggagcaccatcatggctga

DBGET integrated database retrieval system