KEGG   Pseudomonas entomophila: PSEEN2183Help
Entry
PSEEN2183         CDS       T00362                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pen  Pseudomonas entomophila
Pathway
pen00071  Fatty acid degradation
pen00280  Valine, leucine and isoleucine degradation
pen00281  Geraniol degradation
pen00310  Lysine degradation
pen00360  Phenylalanine metabolism
pen00362  Benzoate degradation
pen00380  Tryptophan metabolism
pen00410  beta-Alanine metabolism
pen00627  Aminobenzoate degradation
pen00640  Propanoate metabolism
pen00650  Butanoate metabolism
pen00903  Limonene and pinene degradation
pen00930  Caprolactam degradation
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01212  Fatty acid metabolism
Module
pen_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSEEN2183
   00650 Butanoate metabolism
    PSEEN2183
  Lipid metabolism
   00071 Fatty acid degradation
    PSEEN2183
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSEEN2183
   00310 Lysine degradation
    PSEEN2183
   00360 Phenylalanine metabolism
    PSEEN2183
   00380 Tryptophan metabolism
    PSEEN2183
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSEEN2183
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSEEN2183
   00281 Geraniol degradation
    PSEEN2183
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSEEN2183
   00627 Aminobenzoate degradation
    PSEEN2183
   00930 Caprolactam degradation
    PSEEN2183
Enzymes [BR:pen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSEEN2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAK15006
UniProt: Q1IBF9
Position
2295014..2295826
Genome map
AA seq 270 aa AA seqDB search
MTDYTAFKVELTDNIAHVQINRPEKINAMNAAFWEEIVDIFQWIDETDAVRAVVISGAGK
HFSSGIDLMMLASLAGQMGKDVGRNARLLRRTILRLQSSFNAVDNCRKPVLAAIQGYCIG
GAIDLVSACDMRYCASDAQFSIKEIDMGMAADVGTLQRLPRIIGDGILRELAYTGRNVDA
DEALRIGLVNRVYADQAALLDGVFAIAREIAAKSPVAVAGTKEMLSYMRDHRIDDGLEYI
ATWNAAMLQSEDLRVAVAAHMSKQQPTFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgactacaccgctttcaaagtcgaactgaccgataacatcgcccacgtgcaaatc
aaccgcccggaaaagatcaacgcgatgaatgccgcgttctgggaggagatcgtcgacatc
ttccagtggatcgacgaaaccgacgcggtgcgcgcggtggtcatcagcggtgcgggcaag
catttctcctcgggcatcgacctgatgatgctggcctcgctggccggccagatgggcaag
gacgtcggccgcaacgcccgcctgctgcgccgtaccatcctgcgcctgcaaagctccttc
aacgccgtggacaattgccgcaagccggtgctggcggcgatccagggctactgcatcggg
ggcgccatcgacctggtctcggcctgcgacatgcgctactgcgccagtgacgcgcagttc
tcgatcaaggagatcgacatgggcatggccgccgatgtcggcactctgcaacgtctgccg
cgtatcatcggcgacggcatcctgcgcgagctggcctacaccgggcgcaacgtggacgcc
gacgaggcgctgcgcatcggcctggtcaaccgtgtctacgctgaccaggcggcgctgctc
gacggggtctttgccatcgcccgggaaattgccgcaaaatcaccggtcgcggtggccggc
accaaggagatgctcagctacatgcgcgaccatcgcatcgacgatggcctggagtacatc
gccacctggaacgccgccatgctgcagtccgaagacctgcgcgtggccgtggccgcccac
atgagcaaacagcaaccgacgttcgccgactga

DBGET integrated database retrieval system