KEGG   Pseudomonas entomophila: PSEEN2294Help
Entry
PSEEN2294         CDS       T00362                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pen  Pseudomonas entomophila
Pathway
pen00040  Pentose and glucuronate interconversions
pen00052  Galactose metabolism
pen00500  Starch and sucrose metabolism
pen00520  Amino sugar and nucleotide sugar metabolism
pen01100  Metabolic pathways
pen01130  Biosynthesis of antibiotics
Module
pen_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSEEN2294 (galU)
   00052 Galactose metabolism
    PSEEN2294 (galU)
   00500 Starch and sucrose metabolism
    PSEEN2294 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSEEN2294 (galU)
Enzymes [BR:pen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSEEN2294 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAK15107
UniProt: Q1IB59
Position
2382413..2383252
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLHQISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGEGVLAQMVALYKKYRCSIVAIQEVDPQETNKYGVIAGEEIKD
GIFRVDAMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAE
GNVIAYKFKGKRFDCGGAEGYIEATNFCFEHFYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgcttgttcccggcagccggttacggcactcgtttcctgcccgctacc
aaagccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtatggcgtt
gaagaggcactggacgccggtctgcatcagatctccatcgtcactggccgtggcaagcgt
gccctggaagaccacttcgatatcagctacgagctggaaaaccagatcaaaggcaccgac
aaggaaaaatacctggtcggcatccgccgtctgctcgacgagtgctccttctcctacacc
cgtcagaccgagatgaaaggcctgggccatgccattctcaccggccgcccgctgatcggc
gatgagccgttcgccgtggtgctggccgacgacctgtgcgtcaacctcgaaggtgaaggc
gtgctcgcgcagatggtcgcgctgtacaagaagtaccgctgctcgatcgtcgccatccag
gaagtcgatccgcaggaaaccaacaagtacggcgttatcgccggtgaagaaatcaaggac
ggcatcttccgtgtcgacgccatggtcgagaagccgaagccggaagacgcaccgtccaac
ctggccatcatcggtcgctacatcctgaccccggacatcttcgagaagatcgaacagacc
gaacccggcaagggcggcgaaatccagatcaccgatgcgctgatgaagcaggccgcagaa
ggcaacgtgatcgcctacaagttcaagggcaagcgtttcgactgcggtggcgccgagggt
tacatcgaggcgaccaacttctgcttcgagcacttctacaagaccggcaaggcgtactga

DBGET integrated database retrieval system