KEGG   Pseudomonas entomophila: PSEEN2434Help
Entry
PSEEN2434         CDS       T00362                                 

Definition
magnesium chelatase subunit ChII (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pen  Pseudomonas entomophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSEEN2434
Enzymes [BR:pen01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PSEEN2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2529280..2530278
Genome map
AA seq 332 aa AA seqDB search
MSEPVQFPLAAVVGADDLKLALCLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLGDGPF
VTLPLGATEERLVGTLDLDAALGQGQARFSPGVLAHADGGVLYVDEVNLLPDPLVDLLLD
VAASGTNRVERDGISHRHAARFVLIGTMNPEEGELRPQLLDRFGLNVALDGLPAPEARQQ
IIRRRLAFDSDPEAFCAEWAQAQAQLRERCHAARGQLASIALDDQALAWITERCFAAGVD
GLRADLVWLRAARAHAAWRGSAAIEEADVDAVAEFALRHRRRADAQQPAPADAAEPSPGR
EREQGQGDWGALPPQPVVGGARREVPNWAKKP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacccgtgcaattccccctggcggccgtggtcggcgccgacgatctcaagctg
gccctgtgcctgacggccatcgacccgaagatcggtggcgtgctgatcgaaggcccgcgc
ggcatggccaagagcaccctggcccggggccttgccgacttgctcggtgacgggccgttc
gtgaccttgccgctgggcgcgaccgaagagcgcctggtcggtaccctcgacctggatgcc
gccctgggccagggccaggcgcgtttctcgccgggggtgttggcccatgccgacggcggc
gtgctgtacgtcgacgaggtcaacctgctgcccgacccgctggtggacctgctgctggac
gtggccgccagcggcaccaaccgcgtcgaacgcgatggcatctcccatcgccatgccgcc
cgcttcgtgctgatcggcaccatgaacccggaagaaggtgagctgcgcccgcagttgctc
gaccgtttcggcctcaatgtcgccctcgacggcttgccggcgcccgaagcccggcagcag
atcatccgtcgacgcctggcgttcgacagcgaccccgaggcattctgcgccgagtgggcg
caagcgcaggcgcaactgcgtgagcgctgccacgcggcgcgtgggcaactggcttcgatt
gccctggacgaccaggccctggcctggattaccgagcgctgttttgccgccggcgtcgat
ggcctgcgtgccgacctggtctggctgcgcgctgcccgggcccatgctgcctggcgtggt
agcgcggccatcgaggaagcggatgtcgatgcggtggccgagtttgccttgcgccaccga
cggcgcgccgatgcgcaacaaccggcgccggccgatgcggcggaaccgtcgccggggcgg
gagcgtgaacaggggcagggcgactggggggcattgccgccacagccagtagtcggcggt
gcgcggcgcgaggtgccgaactgggcaaaaaagccctga

DBGET integrated database retrieval system