KEGG   Pseudomonas entomophila: PSEEN2519Help
Entry
PSEEN2519         CDS       T00362                                 

Definition
(GenBank) putative GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pen  Pseudomonas entomophila
Pathway
pen00790  Folate biosynthesis
pen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSEEN2519
Enzymes [BR:pen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PSEEN2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAK15323
UniProt: Q1IAJ6
Position
2641985..2642593
Genome map
AA seq 202 aa AA seqDB search
MQNDKERSHAKARQGVIDILEYLGEDTNRQGLHETPERFLKSMVAQTVGYSQDPYRVLEK
FFEEVAGYKNLIMLQNIHFESMCEHHLAPIVGNATVGYIPNGRVVGLSKLARVVDIFAKR
LQIQERLTSEIGLALDEVLRPKGVGVIIRAKHNCLCTRGAYKPNANMTTTYFSGVLDSDA
IKRGEFYTAAALPWGNGVHHSQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgataaagaacgttcccacgccaaagcccgacaaggcgttatcgatattctc
gaatacctgggtgaagacaccaatcgccaaggccttcatgaaaccccggagcgcttcttg
aaatcgatggtcgcgcagaccgtgggttattcccaggacccgtatcgggtactggagaag
ttcttcgaggaagtggccggctacaagaacctgatcatgttgcagaacatccacttcgag
tcgatgtgcgagcaccacctggcgccgatcgtcggtaacgccaccgtcggctacatcccc
aatggccgggtggtgggcctgtccaagctggcccgggtggtggacatcttcgccaagcgc
ctgcagatccaggagcgcctgacttcggagatcggcctggccctggacgaagtgctgcgc
cccaaaggcgtgggggtgatcatccgcgccaagcacaactgcctgtgcacccgcggcgcc
tacaagcccaacgccaacatgaccaccacctacttctccggcgtgctggacagcgacgcg
atcaagcgcggcgagttctacaccgctgcggcgttgccatggggcaatggcgttcaccac
tctcagtaa

DBGET integrated database retrieval system