KEGG   Pseudomonas entomophila: PSEEN2519Help
Entry
PSEEN2519         CDS       T00362                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pen  Pseudomonas entomophila
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pen00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2641985..2642593
Genome map
AA seq 202 aa AA seqDB search
MQNDKERSHAKARQGVIDILEYLGEDTNRQGLHETPERFLKSMVAQTVGYSQDPYRVLEK
FFEEVAGYKNLIMLQNIHFESMCEHHLAPIVGNATVGYIPNGRVVGLSKLARVVDIFAKR
LQIQERLTSEIGLALDEVLRPKGVGVIIRAKHNCLCTRGAYKPNANMTTTYFSGVLDSDA
IKRGEFYTAAALPWGNGVHHSQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgataaagaacgttcccacgccaaagcccgacaaggcgttatcgatattctc
gaatacctgggtgaagacaccaatcgccaaggccttcatgaaaccccggagcgcttcttg
aaatcgatggtcgcgcagaccgtgggttattcccaggacccgtatcgggtactggagaag
ttcttcgaggaagtggccggctacaagaacctgatcatgttgcagaacatccacttcgag
tcgatgtgcgagcaccacctggcgccgatcgtcggtaacgccaccgtcggctacatcccc
aatggccgggtggtgggcctgtccaagctggcccgggtggtggacatcttcgccaagcgc
ctgcagatccaggagcgcctgacttcggagatcggcctggccctggacgaagtgctgcgc
cccaaaggcgtgggggtgatcatccgcgccaagcacaactgcctgtgcacccgcggcgcc
tacaagcccaacgccaacatgaccaccacctacttctccggcgtgctggacagcgacgcg
atcaagcgcggcgagttctacaccgctgcggcgttgccatggggcaatggcgttcaccac
tctcagtaa

DBGET integrated database retrieval system