KEGG   Pseudomonas entomophila: PSEEN2606Help
Entry
PSEEN2606         CDS       T00362                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pen  Pseudomonas entomophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEEN2606
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSEEN2606
Enzymes [BR:pen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PSEEN2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720009..2720947
Genome map
AA seq 312 aa AA seqDB search
MPKANLTHLQVIAAPSNLGLSPLRPNHEPGTWRAPAALVAAGLLEAVNARTFNALPRPTY
SPAAQPGTRLRNGHALRAFNLALADLVAQAHRQGDLPLVIGGDCSVLLGALAGARQAGPL
SLIHIDGHSDFRHPGNYNPEQTLGAVAGMDLALATGRGEALATHWPGITAPLVADAHVVQ
LGERENRDEDFAWPDINHTAINRIDVFEALAIGPDAVVRRIGDVLDQAPGQGFWIHLDVD
VLDQATMPAVDSPGTPGLAPDDLVKIMTPFVVDRRCHGMTVTVFDPDLDPDGRYAAMIVG
ILARLPFPSGPD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaggcaaacctcactcacctgcaagtcatcgccgccccctccaacctggggctc
agccccctgcgaccgaaccatgaacccggcacatggcgtgccccggccgcattggtggct
gccggcctgctcgaggcggtcaacgcacggaccttcaatgccttgccgcgccccacctat
tcacccgcggcgcaacctggaacacgcttgcgcaatggccacgccctgcgtgcgttcaac
ctcgcactggcggacctggtcgcgcaggcccatcgacagggcgatttaccgctcgtgatc
ggcggcgattgctcggtgctgctgggggcgcttgcaggcgcgcgacaggcggggccgctt
tcactgattcatatcgatgggcacagcgattttcgtcatcccggcaactacaaccccgag
cagacgctgggtgccgtggcaggcatggaccttgccctggcgaccggccgtggcgaagcg
ctggcgacgcattggccgggcataacggccccgctagttgccgatgcccatgtcgtgcag
ttgggtgagcgtgaaaaccgcgacgaggatttcgcttggcccgatatcaaccacaccgcg
atcaaccggatcgatgttttcgaggcgctggcgatcggccccgatgccgttgtgcggcgt
ataggcgacgtgcttgatcaagcgcctggccaagggttctggattcatctcgatgtcgat
gtgctggatcaagccaccatgcccgctgtcgattcccctggtaccccagggctcgcgccg
gacgatctggtgaagatcatgacacccttcgtggtcgatcgacgctgccacggcatgacg
gtgaccgtctttgatcctgacctggaccctgacggtcgatacgccgccatgatcgtcggg
atcctggcgcgacttccgtttccgagcggtcccgattga

DBGET integrated database retrieval system