KEGG   Pseudomonas entomophila: PSEEN2664Help
Entry
PSEEN2664         CDS       T00362                                 

Definition
D-amino acid dehydrogenase small subunit (EC:1.4.99.1)
Orthology
K00285  
D-amino-acid dehydrogenase [EC:1.4.99.1]
Organism
pen  Pseudomonas entomophila
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    PSEEN2664
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.99  With other, unknown, acceptors
    1.4.99.1  D-amino-acid dehydrogenase
     PSEEN2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2784898..2786142)
Genome map
AA seq 414 aa AA seqDB search
MHCQTIVLGAGIVGVSTALHLQARGRQVILVDRDEPGCGTSHGNAGLIERSSVIPYAFPR
KFGALLRYGLNRQPDVRYSLTHLPKAAPWLLRYWQQSAPGRLAKAAADMLPLVQRSVEEH
DALIDAAGLQDLVQAKGWIEVYRDSALFEQAKRELPGLARYGLRYEILEHDQLQAREQQL
DGGVVGGIHWLDPKTVSNPGGLTRGYAGLFVQRGGQFLHGDARTLRQVDGGWQVDTQRGP
VRADEVVACLGPQSAELYEALGYDFPLGIKRGYHMHYATRDGAELRHSVCDTQGGYVLAP
MARGVRLTTGIEFAASDAAANEIQLRRCEALARKLFPALGERLDDKPWLGRRPCLPDMRP
VIGPAPRHKGLWFNFGHAHHGLTLGPVSGRLLAELLTGQHPFTDPAPYSAARFD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcattgccaaaccatcgttctgggcgccggcatcgtcggcgtcagcaccgcgctgcat
ttgcaggcgcgtggccgccaggtgatcctggtcgaccgcgacgagcccggctgcggcacc
agccacggcaacgccggcctgatcgagcgctccagcgtgatcccctacgccttcccacgc
aagttcggcgcactgctgcgctacggcctgaaccgccaaccggacgtgcgctacagcctg
acgcacctgcccaaggccgccccctggctgttgcgctactggcagcagtcggcgccgggg
cgcctggccaaggccgccgcggacatgctgccgctggtgcagcgcagtgtcgaggaacac
gacgcgctgatcgacgccgccgggttgcaggacctcgtgcaagccaagggctggatcgag
gtgtaccgcgacagcgcgctgttcgaacaggccaagcgtgaactgcctggcttggcccgc
tatgggctgcgctacgaaatcctcgagcatgatcaactccaggctcgcgaacagcagctc
gacggtggcgtggtcggcggcatccactggctggacccgaagaccgtgagcaaccctggc
ggcctcacccgtggctatgccgggttgttcgtccagcgcggcgggcagttcctgcacggc
gatgcgcgcaccctgcgccaggtcgacggcggctggcaggtggacacgcagcgtggcccg
gtccgtgccgacgaggtggtggcctgcctcgggccgcagtcggctgagctctatgaagcg
ctgggctatgacttccccctggggatcaagcgcggctaccacatgcactacgccacccgc
gacggtgccgagctgcgccactcggtgtgcgacacccagggcggctatgtgctggcgccc
atggcccgaggcgtacgcctgaccaccggcatcgagttcgccgccagcgacgcggccgcc
aatgaaatccagctgcggcgctgcgaagccctggcccgcaaattgttcccggccctgggc
gagcgcctggacgacaagccttggctgggccggcgcccctgcctgccggacatgcgcccg
gtgatcggccccgcgccacggcacaaaggcctgtggttcaacttcggccacgcccaccac
ggcctgaccctgggcccggtcagcggccgcctgctggcggaactgctcaccggccagcat
cccttcaccgaccctgcgccctacagcgccgcacgcttcgactga

DBGET integrated database retrieval system