KEGG   Pseudomonas entomophila: PSEEN2664Help
Entry
PSEEN2664         CDS       T00362                                 

Definition
D-amino acid dehydrogenase small subunit (EC:1.4.99.1)
Orthology
K00285  
D-amino-acid dehydrogenase [EC:1.4.99.1]
Organism
pen  Pseudomonas entomophila
Pathway
Phenylalanine metabolism
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:pen00360]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2784898..2786142)
Genome map
AA seq 414 aa AA seqDB search
MHCQTIVLGAGIVGVSTALHLQARGRQVILVDRDEPGCGTSHGNAGLIERSSVIPYAFPR
KFGALLRYGLNRQPDVRYSLTHLPKAAPWLLRYWQQSAPGRLAKAAADMLPLVQRSVEEH
DALIDAAGLQDLVQAKGWIEVYRDSALFEQAKRELPGLARYGLRYEILEHDQLQAREQQL
DGGVVGGIHWLDPKTVSNPGGLTRGYAGLFVQRGGQFLHGDARTLRQVDGGWQVDTQRGP
VRADEVVACLGPQSAELYEALGYDFPLGIKRGYHMHYATRDGAELRHSVCDTQGGYVLAP
MARGVRLTTGIEFAASDAAANEIQLRRCEALARKLFPALGERLDDKPWLGRRPCLPDMRP
VIGPAPRHKGLWFNFGHAHHGLTLGPVSGRLLAELLTGQHPFTDPAPYSAARFD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcattgccaaaccatcgttctgggcgccggcatcgtcggcgtcagcaccgcgctgcat
ttgcaggcgcgtggccgccaggtgatcctggtcgaccgcgacgagcccggctgcggcacc
agccacggcaacgccggcctgatcgagcgctccagcgtgatcccctacgccttcccacgc
aagttcggcgcactgctgcgctacggcctgaaccgccaaccggacgtgcgctacagcctg
acgcacctgcccaaggccgccccctggctgttgcgctactggcagcagtcggcgccgggg
cgcctggccaaggccgccgcggacatgctgccgctggtgcagcgcagtgtcgaggaacac
gacgcgctgatcgacgccgccgggttgcaggacctcgtgcaagccaagggctggatcgag
gtgtaccgcgacagcgcgctgttcgaacaggccaagcgtgaactgcctggcttggcccgc
tatgggctgcgctacgaaatcctcgagcatgatcaactccaggctcgcgaacagcagctc
gacggtggcgtggtcggcggcatccactggctggacccgaagaccgtgagcaaccctggc
ggcctcacccgtggctatgccgggttgttcgtccagcgcggcgggcagttcctgcacggc
gatgcgcgcaccctgcgccaggtcgacggcggctggcaggtggacacgcagcgtggcccg
gtccgtgccgacgaggtggtggcctgcctcgggccgcagtcggctgagctctatgaagcg
ctgggctatgacttccccctggggatcaagcgcggctaccacatgcactacgccacccgc
gacggtgccgagctgcgccactcggtgtgcgacacccagggcggctatgtgctggcgccc
atggcccgaggcgtacgcctgaccaccggcatcgagttcgccgccagcgacgcggccgcc
aatgaaatccagctgcggcgctgcgaagccctggcccgcaaattgttcccggccctgggc
gagcgcctggacgacaagccttggctgggccggcgcccctgcctgccggacatgcgcccg
gtgatcggccccgcgccacggcacaaaggcctgtggttcaacttcggccacgcccaccac
ggcctgaccctgggcccggtcagcggccgcctgctggcggaactgctcaccggccagcat
cccttcaccgaccctgcgccctacagcgccgcacgcttcgactga

DBGET integrated database retrieval system