KEGG   Pseudomonas entomophila: PSEEN2791Help
Entry
PSEEN2791         CDS       T00362                                 

Gene name
phaA
Definition
enoyl-CoA hydratase-isomerase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pen  Pseudomonas entomophila
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PSEEN2791 (phaA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSEEN2791 (phaA)
   00650 Butanoate metabolism
    PSEEN2791 (phaA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSEEN2791 (phaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSEEN2791 (phaA)
   00310 Lysine degradation
    PSEEN2791 (phaA)
   00360 Phenylalanine metabolism
    PSEEN2791 (phaA)
   00380 Tryptophan metabolism
    PSEEN2791 (phaA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSEEN2791 (phaA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSEEN2791 (phaA)
   00281 Geraniol degradation
    PSEEN2791 (phaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSEEN2791 (phaA)
   00627 Aminobenzoate degradation
    PSEEN2791 (phaA)
   00930 Caprolactam degradation
    PSEEN2791 (phaA)
Enzymes [BR:pen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSEEN2791 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2930217..2930990
Genome map
AA seq 257 aa AA seqDB search
MPRNLVVQAPADGVRLVTLQRLQALNALNTELLVELASELEAAERDPQVRALVITGSRKA
FAAGADINEMAERDLVGILNDPRVACWQRIGAFSKPLIAAVNGFALGGGCELVMCADIVI
AGSDARFGQPEINLGILPGAGGTQRLLRAVGKPLAMQMVLTGEAIDARHALRAGLISEVT
QPELTVERALQVASAIAAKAPLAVRLAKEALLKAQDMDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRPARFHGL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcaacctcgttgtgcaggcaccagcggacggcgtccgcctggtcaccctgcaa
cgcctacaagccctcaacgccttgaacaccgaactgttggtcgagctcgccagcgaactg
gaggcggccgagcgcgatccgcaggtccgcgccctggtcatcaccggcagccgcaaggcc
ttcgccgcaggtgccgatatcaatgagatggccgagcgcgacctggtcggcatcctcaac
gacccacgggtggcctgctggcaacgcatcggcgccttctccaaacccctgatcgccgcc
gtcaacggcttcgccctgggcggtggctgcgagctggtgatgtgcgccgatatcgtcatc
gccggcagcgacgcccgcttcggccagccggaaatcaacctcggcatccttcccggcgcc
ggtggcacccaacgcctgctgcgcgccgtgggcaagcccctggccatgcagatggtgctc
accggcgaagccatcgatgcccgccacgccttgcgggccggcttgatcagcgaggtcacc
cagccagagctgaccgtcgagcgcgccctgcaggtggccagcgccatcgccgccaaggcg
ccgctggcggtgcggctggccaaggaagcactgctcaaggcacaggacatggacctcgcc
agcggcctgcgcttcgagcgccacgctttcaccctgctggccggcaccgccgaccgcgac
gaaggcattcgcgccttccaggaaaaacgcccggcccgattccacgggctgtaa

DBGET integrated database retrieval system