KEGG   Pseudomonas entomophila: PSEEN3158Help
Entry
PSEEN3158         CDS       T00362                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pen  Pseudomonas entomophila
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pen00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pen00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3377692..3378462
Genome map
AA seq 256 aa AA seqDB search
MTLKGKTALVTGSTSGIGLGIAQVLAEAGANILLNGFGDPAPALAEIARHGVKVAHHPAD
LSDVTQIEQMFALVEREFGALDILVNNAGIQHVAPVEQFPVEAWDKIIALNLSAVFHGSR
LALPGMRARGWGRIVNIASVHGLVGSTGKAAYVAAKHGVVGLTKVIGLETATSNVTCNAI
CPGWVLTPLVQKQIDDRAAKGGDPLQAQHDLLAEKQPSLAFVTPRHLGELVLFLCSEAGS
QVRGAAWNVDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaaaggcaagaccgcactggtcaccggttccaccagcggcattgggctgggc
atcgcccaggtactggccgaggccggcgcgaacatcctgctcaacggctttggcgacccg
gcaccggccctcgccgaaatcgcccgccacggcgtgaaagtcgcccatcatcccgccgac
ctgtccgacgtgacgcagatcgaacagatgttcgccctggtcgagcgcgagttcggcgcg
ctggatatcctcgtcaacaacgccggcatccagcacgtggcgccggtcgagcagtttccg
gtcgaggcctgggacaagatcatcgccctcaacctgtcggcggtgttccatggcagccgc
ctggcgctgccgggcatgcgcgcacggggttggggacgtatcgtcaacatcgcctcggtg
catggcttggtaggctcgaccggcaaggccgcctacgtggccgccaagcatggcgtggtc
ggtctgaccaaggtgatcgggctggagaccgccaccagcaacgtcacctgcaatgccatc
tgcccaggctgggtgctgaccccgctggtgcagaagcagatcgatgatcgtgcggccaag
ggtggcgatccgctgcaggcacagcacgacctgctggccgagaagcagccgtccctggcc
ttcgtgacaccccgccacctcggcgaactggtattgttcctgtgcagcgaggccggcagc
caggtccgcggcgccgcctggaatgtcgacggcggctggctcgcccagtga

DBGET integrated database retrieval system