KEGG   Pseudomonas entomophila: PSEEN3203Help
Entry
PSEEN3203         CDS       T00362                                 

Definition
methylesterase, CheB-like (EC:3.1.1.-)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pen  Pseudomonas entomophila
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pen02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pen02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3432884..3433459)
Genome map
AA seq 191 aa AA seqDB search
MTGIRAVVIGASAGGVTALFSVLGALPDSFTIPVLCVLHLPDDRHSQLADVLQRRLRRPV
REAVDKACIEAGFIYVAGPGYHLSVERDFTLSLSQEEPVHFSRPAIDYLFESAADAYGPG
LLGVLLTGANEDGARGLLRIRQSGGRTVVQDPRDAQVALMPEAALALQQPDHLLPLSGIG
QLLATLEPSAC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatacgcgcggtggtcatcggtgcctcggcgggcggcgtgacggcgctgttc
agcgtgctgggtgcgttgccggacagcttcaccatcccggtactgtgcgtgctgcacttg
ccggacgaccgccacagccagttggcggacgtgctgcagcggcgcctgcgccgaccagtg
cgagaggccgtcgacaaggcttgcatcgaggcaggtttcatctatgtggccgggccgggc
tatcacttgtcggtggagcgtgatttcaccctgtcgctcagccaggaggagccggtgcat
ttctcgcgaccggcgatcgactacctgttcgagtcggcggcggacgcctacggcccgggc
ctgctcggcgtgctgctcaccggggccaacgaagatggtgcccgggggctgttgcgcatc
cgacaaagcggtggccggaccgtggtccaggacccccgcgacgcacaggtcgcgctgatg
ccggaggccgcactggccctgcagcagcccgaccatctacttcccctgagtggtatcggg
cagttgctcgctaccctggaacccagcgcatgctaa

DBGET integrated database retrieval system