KEGG   Pseudomonas entomophila: PSEEN3252Help
Entry
PSEEN3252         CDS       T00362                                 

Definition
putative oxidoreductase
Orthology
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
pen  Pseudomonas entomophila
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEEN3252
  Energy metabolism
   00910 Nitrogen metabolism
    PSEEN3252
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSEEN3252
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     PSEEN3252
    1.4.1.14  glutamate synthase (NADH)
     PSEEN3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3511338..3512705)
Genome map
AA seq 455 aa AA seqDB search
MIDALNHLPRPRAGADQLAERFTDLAPPLTARQAALESARCLYCYDAPCVNACPSDIDIP
SFIHRISDENLQGAAERILSANILGGSCARVCPTEILCQQACVRNNAQECAPVLIGQLQR
YALDNAQFSEHPFKRAPATGKRIAVVGAGPAGLSCAHRLAMHGHDVVVFEAREKAGGLNE
YGIARYKLVDDYAQREVEFLLGIGGIEIRHGQRLGDNLALGELHSQYDAVFLGLGLNAVR
QLGVPDEEAPGLLAATEYIRELRQADDLSQLPLADHSLVIGAGNTAIDMAVQMSRLGARD
VNLVYRRGEADMGATGHEQEIAKQNQVRLHTWARPDAVLLDDQGRVRGMRFVRTQLVDGR
LTDTDEAFELAADAIFKAIGQRFDDASLGDPLAAQLARDGERIRVDDHMRTSLPGIYAGG
DCTALGQDLTVQAVQHGKLAAEAIHAQLMLNVEAA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacgccctgaaccatttgccgcgcccccgggccggcgccgaccagctggccgag
cgcttcaccgacctcgcgcccccgctcaccgcccgccaggccgccctcgaaagcgcgcgt
tgcctgtactgctacgacgcgccctgcgtcaacgcttgccccagcgacatcgacatcccc
tcgttcatccaccgcatcagcgatgagaacctgcaaggcgccgccgagcgcatcctctcg
gccaacatcctcggcggcagttgcgcccgggtgtgcccgaccgaaatcctctgccagcag
gcctgcgtgcgcaacaatgcccaggagtgcgcgccggtgctgatcggccaactgcaacgc
tatgccctggacaacgcccagttcagcgaacaccccttcaagcgcgcgcccgccaccggc
aagcgcatcgccgtggtcggcgccgggcctgcggggctgtcctgcgcccaccgcctggcc
atgcatggccatgacgtggtggtgttcgaggcgcgggagaaggcgggtggcctcaacgaa
tacggcatcgcccgctacaagctggtggacgactacgcccagcgcgaagtcgagttcctg
ctgggcatcggcggcatcgagatccgccacggccagcgcctgggcgacaacctcgcgctg
ggcgagctgcacagccagtacgacgccgtgttcctcggcctaggcctgaacgctgtgcgg
caactgggggtgccggacgaggaggcccccggcctgctggccgctaccgaatacatccgt
gaactgcgccaggccgacgacctgagccagctgccattggccgaccacagcctggtgatc
ggcgccggcaacaccgccatcgacatggccgtgcagatgagccgcctgggcgcccgcgac
gtcaacctggtgtaccgccgtggcgaggccgacatgggcgccaccggccatgagcaggaa
attgccaagcagaaccaggtgcgcctgcacacctgggcgcgccccgatgccgtgctgctc
gatgaccagggccgcgtgcgcggcatgcgtttcgtgcgcacccaactggtcgatggccgc
ctgacggatacggacgaggctttcgagttggccgctgacgcgatcttcaaggccatcggc
caacgctttgacgacgcaagcctcggcgacccgctggccgcacaactggcccgcgacggc
gaacgcatccgcgtcgacgatcacatgcgcaccagcctgccgggcatctacgccggtggc
gactgcaccgccctgggccaggaccttaccgtccaggccgtgcaacatggcaagctggcc
gccgaagccatccatgcccaactcatgctcaacgtggaggctgcgtaa

DBGET integrated database retrieval system