KEGG   Pseudomonas entomophila: PSEEN3252Help
Entry
PSEEN3252         CDS       T00362                                 

Definition
(RefSeq) putative oxidoreductase
  KO
K17722  
dihydropyrimidine dehydrogenase (NAD+) subunit PreT [EC:1.3.1.1]
Organism
pen  Pseudomonas entomophila
Pathway
Pyrimidine metabolism
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSEEN3252
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSEEN3252
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PSEEN3252
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.1  dihydropyrimidine dehydrogenase (NAD+)
     PSEEN3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3511338..3512705)
Genome map
AA seq 455 aa AA seqDB search
MIDALNHLPRPRAGADQLAERFTDLAPPLTARQAALESARCLYCYDAPCVNACPSDIDIP
SFIHRISDENLQGAAERILSANILGGSCARVCPTEILCQQACVRNNAQECAPVLIGQLQR
YALDNAQFSEHPFKRAPATGKRIAVVGAGPAGLSCAHRLAMHGHDVVVFEAREKAGGLNE
YGIARYKLVDDYAQREVEFLLGIGGIEIRHGQRLGDNLALGELHSQYDAVFLGLGLNAVR
QLGVPDEEAPGLLAATEYIRELRQADDLSQLPLADHSLVIGAGNTAIDMAVQMSRLGARD
VNLVYRRGEADMGATGHEQEIAKQNQVRLHTWARPDAVLLDDQGRVRGMRFVRTQLVDGR
LTDTDEAFELAADAIFKAIGQRFDDASLGDPLAAQLARDGERIRVDDHMRTSLPGIYAGG
DCTALGQDLTVQAVQHGKLAAEAIHAQLMLNVEAA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacgccctgaaccatttgccgcgcccccgggccggcgccgaccagctggccgag
cgcttcaccgacctcgcgcccccgctcaccgcccgccaggccgccctcgaaagcgcgcgt
tgcctgtactgctacgacgcgccctgcgtcaacgcttgccccagcgacatcgacatcccc
tcgttcatccaccgcatcagcgatgagaacctgcaaggcgccgccgagcgcatcctctcg
gccaacatcctcggcggcagttgcgcccgggtgtgcccgaccgaaatcctctgccagcag
gcctgcgtgcgcaacaatgcccaggagtgcgcgccggtgctgatcggccaactgcaacgc
tatgccctggacaacgcccagttcagcgaacaccccttcaagcgcgcgcccgccaccggc
aagcgcatcgccgtggtcggcgccgggcctgcggggctgtcctgcgcccaccgcctggcc
atgcatggccatgacgtggtggtgttcgaggcgcgggagaaggcgggtggcctcaacgaa
tacggcatcgcccgctacaagctggtggacgactacgcccagcgcgaagtcgagttcctg
ctgggcatcggcggcatcgagatccgccacggccagcgcctgggcgacaacctcgcgctg
ggcgagctgcacagccagtacgacgccgtgttcctcggcctaggcctgaacgctgtgcgg
caactgggggtgccggacgaggaggcccccggcctgctggccgctaccgaatacatccgt
gaactgcgccaggccgacgacctgagccagctgccattggccgaccacagcctggtgatc
ggcgccggcaacaccgccatcgacatggccgtgcagatgagccgcctgggcgcccgcgac
gtcaacctggtgtaccgccgtggcgaggccgacatgggcgccaccggccatgagcaggaa
attgccaagcagaaccaggtgcgcctgcacacctgggcgcgccccgatgccgtgctgctc
gatgaccagggccgcgtgcgcggcatgcgtttcgtgcgcacccaactggtcgatggccgc
ctgacggatacggacgaggctttcgagttggccgctgacgcgatcttcaaggccatcggc
caacgctttgacgacgcaagcctcggcgacccgctggccgcacaactggcccgcgacggc
gaacgcatccgcgtcgacgatcacatgcgcaccagcctgccgggcatctacgccggtggc
gactgcaccgccctgggccaggaccttaccgtccaggccgtgcaacatggcaagctggcc
gccgaagccatccatgcccaactcatgctcaacgtggaggctgcgtaa

DBGET integrated database retrieval system