KEGG   Pseudomonas entomophila: PSEEN3252Help
Entry
PSEEN3252         CDS       T00362                                 

Definition
putative oxidoreductase
Orthology
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
pen  Pseudomonas entomophila
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pen01230]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:pen00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pen00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3511338..3512705)
Genome map
AA seq 455 aa AA seqDB search
MIDALNHLPRPRAGADQLAERFTDLAPPLTARQAALESARCLYCYDAPCVNACPSDIDIP
SFIHRISDENLQGAAERILSANILGGSCARVCPTEILCQQACVRNNAQECAPVLIGQLQR
YALDNAQFSEHPFKRAPATGKRIAVVGAGPAGLSCAHRLAMHGHDVVVFEAREKAGGLNE
YGIARYKLVDDYAQREVEFLLGIGGIEIRHGQRLGDNLALGELHSQYDAVFLGLGLNAVR
QLGVPDEEAPGLLAATEYIRELRQADDLSQLPLADHSLVIGAGNTAIDMAVQMSRLGARD
VNLVYRRGEADMGATGHEQEIAKQNQVRLHTWARPDAVLLDDQGRVRGMRFVRTQLVDGR
LTDTDEAFELAADAIFKAIGQRFDDASLGDPLAAQLARDGERIRVDDHMRTSLPGIYAGG
DCTALGQDLTVQAVQHGKLAAEAIHAQLMLNVEAA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacgccctgaaccatttgccgcgcccccgggccggcgccgaccagctggccgag
cgcttcaccgacctcgcgcccccgctcaccgcccgccaggccgccctcgaaagcgcgcgt
tgcctgtactgctacgacgcgccctgcgtcaacgcttgccccagcgacatcgacatcccc
tcgttcatccaccgcatcagcgatgagaacctgcaaggcgccgccgagcgcatcctctcg
gccaacatcctcggcggcagttgcgcccgggtgtgcccgaccgaaatcctctgccagcag
gcctgcgtgcgcaacaatgcccaggagtgcgcgccggtgctgatcggccaactgcaacgc
tatgccctggacaacgcccagttcagcgaacaccccttcaagcgcgcgcccgccaccggc
aagcgcatcgccgtggtcggcgccgggcctgcggggctgtcctgcgcccaccgcctggcc
atgcatggccatgacgtggtggtgttcgaggcgcgggagaaggcgggtggcctcaacgaa
tacggcatcgcccgctacaagctggtggacgactacgcccagcgcgaagtcgagttcctg
ctgggcatcggcggcatcgagatccgccacggccagcgcctgggcgacaacctcgcgctg
ggcgagctgcacagccagtacgacgccgtgttcctcggcctaggcctgaacgctgtgcgg
caactgggggtgccggacgaggaggcccccggcctgctggccgctaccgaatacatccgt
gaactgcgccaggccgacgacctgagccagctgccattggccgaccacagcctggtgatc
ggcgccggcaacaccgccatcgacatggccgtgcagatgagccgcctgggcgcccgcgac
gtcaacctggtgtaccgccgtggcgaggccgacatgggcgccaccggccatgagcaggaa
attgccaagcagaaccaggtgcgcctgcacacctgggcgcgccccgatgccgtgctgctc
gatgaccagggccgcgtgcgcggcatgcgtttcgtgcgcacccaactggtcgatggccgc
ctgacggatacggacgaggctttcgagttggccgctgacgcgatcttcaaggccatcggc
caacgctttgacgacgcaagcctcggcgacccgctggccgcacaactggcccgcgacggc
gaacgcatccgcgtcgacgatcacatgcgcaccagcctgccgggcatctacgccggtggc
gactgcaccgccctgggccaggaccttaccgtccaggccgtgcaacatggcaagctggcc
gccgaagccatccatgcccaactcatgctcaacgtggaggctgcgtaa

DBGET integrated database retrieval system