KEGG   Pseudomonas entomophila: PSEEN3509Help
Entry
PSEEN3509         CDS       T00362                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pen  Pseudomonas entomophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pen00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3788375..3789346)
Genome map
AA seq 323 aa AA seqDB search
MDLAQDNDQAITRDSLYGTSAESTYAGITSFSRRRYSRDLRGVDVVVSGVPFDTATSNRP
GARFGPRAIRTASVQQAWARHWPWAFDPFDHLAVIDYGDCAFDNGTPESVPDSIQAHAER
ILDAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEEGKRIDHGTMFWH
AAREGLVDPAHSVQIGLRTTNDDSQGFAILDARQVHRQGTEAIVAAIRQRVGERPVYLTF
DIDCLDPAYAPGTGTPVCGGLSTLQALEILGGLRGINLVGMDLVEVAPAYDHADITALAG
ATLAMEMLCLYAARHKVDKEEAV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcgcccaggacaacgaccaggccatcacccgtgacagcctctacggcacgtct
gccgagagtacttacgccggtatcaccagcttctccaggcgccgctacagccgtgacctg
cgcggcgtcgatgtagtggtcagcggcgtgccattcgacaccgccaccagcaaccggcca
ggggcgcgcttcgggccgcgggcgatccgcacggcgtcggtgcagcaggcctgggcccgg
cactggccgtgggcgttcgacccgttcgaccacctggcggtaatcgactacggcgactgc
gccttcgacaatggcaccccagagtcggtacccgacagcatccaggcccatgccgagcgt
atcctcgatgccggctgcgccatgctcacccttggtggcgaccacttcatcagctacccg
ttgctcaaggcccatgcccggcggcatggcccgctggcgttgatccacttcgacgcgcac
agtgatacctggccggacgaggagggcaagcgcatcgaccatggcaccatgttctggcat
gccgcccgcgaaggcctggtggacccggcgcactcggtgcagatcggcctgcgcaccacc
aacgatgacagccagggcttcgccatcctcgatgcgcggcaggtgcatcgccagggcacc
gaggcgatcgtcgcggcgatccgccagcgggtcggcgagcggccggtgtacctgacgttc
gatatcgactgcctggacccggcctatgcgcccggtaccggcacgccggtctgcggggga
ctgagcacgttgcaggcactggagatcctgggcgggttgcgtgggatcaacctggtgggg
atggacctggtggaggtggcgccggcctatgaccatgccgacatcaccgcactggcgggg
gcgacgctggcgatggagatgctttgtctttatgcggcgcggcacaaggtggacaaggag
gaggcggtttaa

DBGET integrated database retrieval system