KEGG   Pseudomonas entomophila: PSEEN3549Help
Entry
PSEEN3549         CDS       T00362                                 

Gene name
fadDx
Definition
acetyl-CoA synthetase/AMP-(fatty) acid ligase FadDx
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pen  Pseudomonas entomophila
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEEN3549 (fadDx)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN3549 (fadDx)
   00620 Pyruvate metabolism
    PSEEN3549 (fadDx)
   00640 Propanoate metabolism
    PSEEN3549 (fadDx)
  Energy metabolism
   00680 Methane metabolism
    PSEEN3549 (fadDx)
Enzymes [BR:pen01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSEEN3549 (fadDx)
Lipid biosynthesis proteins [BR:pen01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSEEN3549 (fadDx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3825810..3827456)
Genome map
AA seq 548 aa AA seqDB search
MRDYAEAARSFDHAQAAAAALHGNFEALNACVECCDRHAGMGKTALVWEDRDGDGGRYSF
DQLQALAARFANVLKAQGVGAGDRVAGLMPRTPELLVTILATWRLGAVYQPLFTAFGPKA
IEHRLEQSHAKVVVTDRNNRPKLDDVADCPTIVTVGAAEGELDFQRSLEAAASDCAPVMR
TGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIDLRPEDNFWNLADPGWAYGLY
YAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLLIAAGSAFSAPIKG
RLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHALSHPVHLGSAGFAI
PGHRIVVVDEQGNELPAGQPGILAVDREQSPLCWFAGYHGLPTKAFVGKYYLSGDTVELN
QDGSISFVGRSDDVITTSGYRVGPFDVESALVEHPAVVEAAVIGKPDPERTELIKAFVVL
GKGFEGSPELEETLRQHVRQRLYAHAYPREIEFVGELPKTPSGKLQRFILRNQEIARQQA
AQPIAAGA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgattacgccgaagccgcccgttcgttcgaccatgcccaggctgctgcggcggcg
ctgcatggcaacttcgaggccctcaacgcttgtgtcgagtgctgcgaccgccacgccggc
atgggcaaaaccgctctggtctgggaagaccgtgacggcgacggcgggcgatactccttt
gaccagttgcaggccttggccgcgcgctttgccaatgtgctcaaggcgcaaggcgtaggg
gcgggtgaccgggtcgccgggctgatgccgcgtaccccggaactgttggttaccattctc
gccacctggcgcctgggcgcggtctatcagccgctgtttaccgcgttcgggcccaaagcc
atcgagcaccgcctcgagcagtcccatgccaaggtagtggtcactgaccgcaacaaccga
cccaagctcgacgacgtggcggattgcccgaccatcgtcacggtcggcgcggccgagggc
gagctggacttccagcgcagccttgaagccgccgccagcgattgcgcgccggtgatgcgc
acgggcaacgatccgttcctgctgatgttcacctcaggcaccacggggccggccaagccg
ctggaagtaccgctgcgggccatcgtcgccttccagggctacatgcgcgacgccatcgac
ctgcgcccggaggacaacttctggaacctggccgacccaggttgggcctatgggctctat
tacgctgtcaccgggccgctttcgctgggccacgccaccacgttctacgacggcccgttc
agcgtcgaaagctgcgcccgggtcatcgacaagctgggcatcaccaacctggcgggttca
ccgacggcctatcgcctgttgatcgcggcgggcagcgcgttctcggcaccgatcaagggc
cgcctgcgcgtggtcagcagtgccggcgaaccgctcaaccccgaagtgatccgctggttc
gccgacgagctcggggtgaccatccacgaccactacggccagaccgagttgggcatggtg
ttgtgcaaccaccatgcgctgtcgcatccggtacacctgggctcggccggtttcgccatc
cctggccatcgcatcgtggtggtggacgagcagggcaacgaactgccagccggccagccc
ggtatcctcgcggttgaccgcgagcagtcgccgctgtgctggttcgccggttaccacggg
ttgccgaccaaggccttcgtcggcaagtactacctgtccggcgacaccgtcgaactcaac
caggacggcagcatcagcttcgtcggccgcagcgacgatgtgatcaccacctccggctac
cgggtcggcccgttcgacgtggagagcgcactggtcgagcacccggcggtggtcgaggcg
gcagtgatcggcaagccggatcctgagcgcaccgagctgatcaaggccttcgtggtgctt
ggaaagggcttcgagggcagccccgagctggaggaaaccttgcgccagcacgtacgccag
cgcctttatgcccacgcctatccccgtgaaatcgaattcgtcggcgagctgcccaagacc
ccgagcggcaagctgcaacgcttcatcctgcgcaaccaggaaatcgcccgacaacaagcc
gcgcagccgatcgctgcgggcgcctga

DBGET integrated database retrieval system