KEGG   Pseudomonas entomophila: PSEEN3639Help
Entry
PSEEN3639         CDS       T00362                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pen  Pseudomonas entomophila
Pathway
pen00020  Citrate cycle (TCA cycle)
pen00310  Lysine degradation
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
Module
pen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSEEN3639 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSEEN3639 (sucB)
Enzymes [BR:pen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSEEN3639 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: CAK16368
UniProt: Q1I7L1
Position
complement(3923839..3925056)
Genome map
AA seq 405 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KGEGDTVLSDEVLGSIVEGGAAAAAPAAAPAAAAPAAAAADAGEDDPVAAPAARKLAEEN
GIDLATVAGTGKGGRITKEDVVAAVANKKSAPAPAAKPAAAAAAPVVVAAGDRTEKRVPM
TRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFFVK
AATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENGIA
TFGKKARDGKLAIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAING
QVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagcagccgggcgacgccgtcaagcgtgacgagctgatcgtcgacatcgag
accgacaaggtcgtcctggaagtcctggccaccgccgacggcgtgctgggcgccatcgtc
aagggcgagggcgacaccgtcctgtccgacgaagtcctgggctcgatcgttgaaggtggc
gccgccgccgcggctcctgcggccgctccggccgctgctgcgccggctgccgctgccgcc
gacgctggcgaagacgacccggtcgccgctccagccgcgcgcaagctggctgaagagaac
ggtatcgacctggctaccgttgccggcaccggcaagggcggtcgcatcaccaaggaagac
gtcgtcgctgctgtcgccaacaagaaatcggcacctgctccggccgccaagcctgccgct
gctgccgccgctccggttgtcgttgccgctggcgaccgcaccgagaagcgcgtaccgatg
actcgtctgcgcgccaagatcgccgagcgtctggtcgaagcccagtcgaacatggccatg
ctgaccaccttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaagtacaag
gacctgttcgagaagacccacaacggcgtgcgcctgggcttcatgtcgttcttcgtcaag
gcggccaccgaagcgctgaagcgcttcccggcggtcaacgcctcgatcgacggcaacgac
atcgtctaccacggtttcgctgacgtcggcgtcgctgtttccagcgaccgcggcctggtg
gttccggtactgcgcaacgccgaatcgatgtcgctggccgagatcgagaacggcatcgcc
accttcggcaagaaggcccgtgacggcaagctggccatcgaagagatgactggcggtacc
ttcaccatcaccaacggtggtaccttcggctcgatgatgtcgaccccgatcgtcaacccg
ccgcaggccgcgatcctgggtatgcacaacatcatccagcgcccgatggccatcaatggc
caagtggtgatccgcccgatgatgtacctggcgctgtcctacgaccaccgcctgatcgac
ggcaaggaagcggtaaccttcctggtgaccatcaagaacctgctggaagatccgtctcgc
ctgctgctggacatctaa

DBGET integrated database retrieval system