KEGG   Pseudomonas entomophila: PSEEN3643Help
Entry
PSEEN3643         CDS       T00362                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pen  Pseudomonas entomophila
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEEN3643 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSEEN3643 (sdhD)
   00650 Butanoate metabolism
    PSEEN3643 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSEEN3643 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3930667..3931035)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYLAAHPGIDYAQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacgtcacgaacctctcgcgttcgggcctctacgactggatggcgcagcgc
gtctcggcggtcgttctcgcggcttacttcattttcctgatcggctacctcgccgcgcac
ccgggcatcgattacgcccagtggcacggtctgttctccaacaacgcgatgcgtatcttc
agtctgctggccctcgttgccctgggcgcccacgcctgggtcggcatgtggaccattgcc
accgactacctgacgccgatgtcgttcggcaagtcggcgactgcaattcgtttcctgttc
caggcggtatgcggcgtagcaatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system