KEGG   Pseudomonas entomophila: PSEEN3643Help
Entry
PSEEN3643         CDS       T00362                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pen  Pseudomonas entomophila
Pathway
pen00020  Citrate cycle (TCA cycle)
pen00190  Oxidative phosphorylation
pen00650  Butanoate metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
Module
pen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pen_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSEEN3643 (sdhD)
   00650 Butanoate metabolism
    PSEEN3643 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSEEN3643 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAK16372
UniProt: Q1I7K7
Position
complement(3930667..3931035)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYLAAHPGIDYAQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacgtcacgaacctctcgcgttcgggcctctacgactggatggcgcagcgc
gtctcggcggtcgttctcgcggcttacttcattttcctgatcggctacctcgccgcgcac
ccgggcatcgattacgcccagtggcacggtctgttctccaacaacgcgatgcgtatcttc
agtctgctggccctcgttgccctgggcgcccacgcctgggtcggcatgtggaccattgcc
accgactacctgacgccgatgtcgttcggcaagtcggcgactgcaattcgtttcctgttc
caggcggtatgcggcgtagcaatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system