KEGG   Pseudomonas entomophila: PSEEN3792Help
Entry
PSEEN3792         CDS       T00362                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pen  Pseudomonas entomophila
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pen02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pen02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4070588..4071715)
Genome map
AA seq 375 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALSLKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPEKVKQ
LLCEKVHTISRSNRRFSAYSSPAPAAAPAPASSHTPASSFSSSAPARAAAAPARAAAPAA
THSPAPKRKPYKLVAIGTSTGGPVALQRVLTQLPAGFPAPIVLIQHMPAAFTKAFAERLD
KLCKISVKEAEDGDVLRPGLALLAPGGKQMMVDGRGTVKILPGDERLNYKPCVDITFGSA
AKSYGDKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAV
YSLDEIGKHLVEACV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggatgattccggtttcttccgccgccgtgtctcggaa
attctctcggcggacccgacgatccaggtcgtgggtaccgcgaccaacggcaaggaagcg
atcgaccaggcgttgtcgctcaagcccgatgtcatcaccatggactacgaaatgcccatg
atggatggcatcaccgcggtgcggcacatcatgcaacgctgcccgacgccggtcctgatg
ttctcctcgctgacccatgaaggtgcccgcgtcaccctcgacgccctggacgccggcgcg
gtcgactacctgccgaagaacttcgaggacatctcgcgcaacccggagaaggtcaagcag
ttgctgtgcgaaaaggttcataccatttcccgcagcaaccgccgcttcagcgcctattcc
agcccggcaccggccgctgcgccggctccggccagcagccataccccggccagcagcttc
agcagctccgcgcctgcgcgcgctgccgctgccccggcccgcgccgcggcaccggccgcc
acccattcgccagcgcccaagcgcaagccgtacaagctggtcgccattggtacttccacc
ggtggcccggtggcgctgcaacgggtgctgactcagctgcccgccggtttcccggctccg
atcgtgctcatccagcacatgccggcggccttcaccaaggccttcgccgagcgcctggac
aagctgtgcaagatcagtgtcaaggaagccgaggacggtgacgtgctgcgtcctggcctg
gcgctgctggcccccggtggcaagcagatgatggtcgatggccgtggcacggtgaagatc
ctgccaggtgacgagcgcctgaactacaagccttgcgtcgatatcaccttcggttccgcc
gccaaatcgtatggcgacaaggtgctgtcggtggtgctcaccggcatgggcgccgatggc
cgcgaaggcgcgcgcctgctcaagcagggcggcagcaccgtgtgggcccaggatgaagcc
agctgcgtgatctatggcatgcccatggccatcgtcaaggccaacctggccgatgccgtg
tacagcctggacgagatcggcaagcacctggtcgaggcgtgcgtctga

DBGET integrated database retrieval system