KEGG   Pseudomonas entomophila: PSEEN3862Help
Entry
PSEEN3862         CDS       T00362                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pen  Pseudomonas entomophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEEN3862
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEEN3862
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSEEN3862
Enzymes [BR:pen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSEEN3862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4150032..4151276
Genome map
AA seq 414 aa AA seqDB search
MDRLCRPFVLQCITCGTRYAPYQVEYFCPHCRTDGALDTLYDYDSVRRECDRDRLATQAG
LGMWRYRALLPLDSERYVPRLLVGSTPLYERPGLLETDSGMRVWVKDESRQPTGSLKDRA
SALAVALALESGASTVAVASTGNAASALAGMSAERGLRNVIFIPRTTPREKLAQMIGYGA
EVILVDGAYDEAFEQCRNACESNGWYNRTTGINSYMTEGKKTVAFEICEQLGWQVPDLVF
VPVGNGCILGAVHKGFQDLLKLGWIERMPRLMGVQARDSNFMYRAWSSGLPLEQVEKRAP
TSLASSINVAFPRDRLKALRAVRDSEGEFLCVDDTAIVQAASRLAARTGIFPEAGAASSY
AGLLQYAEQHPHSRESAVLLITGSGLKDTSIYLPSTHTASSAAARQTPATAIAS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtctttgcaggcccttcgttttgcaatgcatcacctgcggcacccgctacgcg
ccgtaccaggtcgaatacttctgccctcattgccgcaccgatggcgccctcgacaccctc
tacgactacgacagcgtgcgccgggaatgcgaccgcgacaggttggcgacccaggccggg
ctgggcatgtggcgttatcgcgcactgctgccgctggacagcgagcgctatgtgccacgc
ctgctggtcggcagcacaccgctgtacgaacgccccggcctgctcgaaaccgacagcggc
atgagagtctgggtcaaggacgaatcccggcagcccaccggttcactgaaggaccgcgcc
agcgccctggcggtggcgctggccctggaaagcggcgccagtacggttgcggtagccagc
accggcaacgccgcctccgcgctcgccggcatgagcgccgagcgcggcctgcgcaatgtg
atcttcatcccccgcaccaccccacgggaaaaactggcgcagatgatcggctatggcgcc
gaggtgatcctggtcgacggcgcctacgacgaagccttcgaacaatgccgcaacgcctgc
gaaagcaatggctggtacaaccgcaccaccggcatcaattcgtacatgaccgaaggcaag
aagaccgtcgccttcgagatctgcgaacagctgggctggcaagtacccgacctggtcttc
gtgccggtcggcaacggctgcattctcggcgcggtgcacaaaggcttccaggacttgctc
aagctaggctggatcgaacgtatgccacggctgatgggcgtccaggcacgggacagcaac
ttcatgtaccgcgcctggtccagcggccttcccctcgagcaagttgaaaaacgcgccccg
acaagcctggcaagcagcatcaacgtggccttcccacgcgatcgcctcaaggcattgcgt
gcggtacgcgacagcgaaggcgagttcctctgtgtcgacgacacggccatcgtccaggcc
gcctcgcgcctggccgctcgcaccgggatctttcccgaggccggcgccgccagcagttac
gccggcctgctgcagtacgccgaacaacacccgcacagtcgcgaaagcgccgtgctgctg
attaccggcagtggccttaaggacacctcgatctacttgccctccacccataccgcctcg
tctgcggctgcccggcagacgccggcaaccgccattgcctcttga

DBGET integrated database retrieval system