KEGG   Pseudomonas entomophila: PSEEN3888Help
Entry
PSEEN3888         CDS       T00362                                 

Gene name
acs-1
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pen  Pseudomonas entomophila
Pathway
pen00010  Glycolysis / Gluconeogenesis
pen00620  Pyruvate metabolism
pen00640  Propanoate metabolism
pen00680  Methane metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN3888 (acs-1)
   00620 Pyruvate metabolism
    PSEEN3888 (acs-1)
   00640 Propanoate metabolism
    PSEEN3888 (acs-1)
  Energy metabolism
   00680 Methane metabolism
    PSEEN3888 (acs-1)
Enzymes [BR:pen01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSEEN3888 (acs-1)
Lipid biosynthesis proteins [BR:pen01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSEEN3888 (acs-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAK16596
UniProt: Q1I6Y6
Position
complement(4174224..4176185)
Genome map
AA seq 653 aa AA seqDB search
MSAAPLYPVRPEVAASTLTDEATYKAMYQQSVINPDGFWREQAQRLDWIKPFTKVKQTSF
DDHHVDIKWFADGTLNVSYNCLDRHLAERGDQVAIIWEGDDPSEHRNITYRELHEQVCKF
ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKS
KVVITADEGVRGGRRTPLKANVDLALTNPETSSVQKIIVCKRTGGDIAWHQHRDIWYEDL
MKVASSHCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRPGEV
YWCTADVGWVTGHSYIVYGPLANGAATLLFEGVPNYPDITRVSKIVDKHKVNILYTAPTA
IRAMMAEGEAAVAGADGSSLRLLGSVGEPINPEAWNWYYKTVGKQRCPIVDTWWQTETGG
VLISPLPGATALKPGSATRPFFGVVPALVDNLGNLIEGAAEGNLVILDSWPGQSRSLYGD
HDRFVDTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHA
KVAEAAVVGVPHDIKGQGIYVYVTLNAGEEPSEQLRLELKNWVRKEIGPIASPDVIQWAP
GLPKTRSGKIMRRILRKIATAEYDALGDISTLADPGVVQHLIDTHKAMNLASA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggctccactgtatcccgttcgtcccgaggttgcggccagtaccctgaccgac
gaggccacctacaaggccatgtaccagcaatcggtgatcaacccggacggcttctggcgc
gagcaggcccagcgtctggactggatcaagcccttcaccaaggtcaagcagacctcgttc
gacgaccaccatgtcgatatcaagtggttcgccgacggcactctgaacgtttcctacaac
tgcctggaccgccaccttgccgagcgcggtgaccaggtcgccatcatctgggagggcgac
gatccttccgagcaccgcaacatcacctaccgcgagctccacgagcaggtctgcaagttc
gccaacgccctgcgtggccaggacgtgcaccgtggcgacgtggtgaccatctacatgccg
atgatccccgaggccgtggtcgccatgctggcctgcgcccgcatcggcgcgatccactcg
gtggtgttcggtggcttctcaccggaagcactggccgggcgcatcatcgactgcaagtcg
aaagtggtgatcactgccgacgaaggtgtgcgcggtgggcgtcgcaccccgctcaaggcc
aacgtcgacctggccctgaccaaccctgaaaccagcagcgtgcagaagatcatcgtgtgc
aagcgcaccggtggcgacatcgcctggcaccagcaccgcgacatctggtacgaagacctg
atgaaggtcgcctccagccactgcgcgccgaaagagatgggcgcggaagaagcgctgttc
atcctttatacctccggttcgaccggcaagccgaagggcgtgctgcacaccaccggcggc
tacctggtctacgccgcgctgactcatgagcgcgtgttcgactaccgtccgggcgaggtc
tactggtgcaccgccgacgtgggctgggtcaccgggcacagctatatcgtctacggcccg
ctggccaatggtgcggccacgctgctgttcgagggcgtgccgaactatccggacatcact
cgcgtgtcgaagatcgtcgacaagcacaaggtcaatatcctctacaccgcgccaactgct
attcgcgccatgatggccgagggcgaggcggcggtggccggtgccgatggctccagcctg
cgcctgctgggttcggtgggcgagccgatcaaccccgaggcctggaactggtactacaag
accgtcggcaagcagcgctgcccgatcgtcgatacctggtggcagaccgagaccggtggc
gtgctgatcagcccgctgccgggcgccaccgcgctgaaaccgggctcggcaacccgtccg
ttcttcggtgtggtaccggcgctggtggacaacctgggcaacctgatcgaaggtgccgcc
gagggcaacctggtgatcctcgactcctggccgggtcagtcgcgttcgctgtacggcgac
cacgaccgtttcgtcgacacctacttcaagaccttccgcggcatgtacttcaccggtgac
ggtgcccgtcgcgacgaagacggctactactggatcaccggccgcgtggacgacgtactc
aacgtatccgggcaccgcatggggaccgccgagatcgagagcgccatggtggcgcacgcg
aaagtcgccgaggcggcggtggtgggtgtgccgcacgacatcaaggggcagggtatctat
gtctatgtcaccctcaatgctggtgaggaaccgagcgagcagctgcgtctggagctgaag
aactgggtgcgcaaggagatcggtccgatcgcctcgccggatgtgatccagtgggcgccc
ggcttgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgtaagatcgccacc
gccgaatacgatgcgctgggtgatatctcgacgctggccgatccgggtgtggtgcagcac
ctgatcgacacccacaaggcgatgaacctggcgtcggcctga

DBGET integrated database retrieval system