KEGG   Pseudomonas entomophila: PSEEN4093Help
Entry
PSEEN4093         CDS       T00362                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pen  Pseudomonas entomophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pen00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSEEN4093 (ruvA)
Enzymes [BR:pen01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PSEEN4093 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4389480..4390097)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGTLAEKQPPHLIIDVNGVGYELEVPMTTLYRLPKVGEPVTVHTHLVVREDAHLL
YGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDASVLVRVPGVGKKT
AERLLVELKDRFKAWETSPAMFTLVSDGPLPVASESSAEADAVSALVSLGYKPQEASKAI
AAIKDKAGLSSEELIRRSLKGMIAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggcaccctggcggaaaaacagccgccgcacctgattatcgac
gtgaacggcgtgggctacgagctggaagtgccgatgaccaccctgtaccgcctgccgaag
gtcggcgagccagtgaccgtgcacactcacctggtggtgcgtgaagacgcccacctgctc
tatggtttcgcggaaaagcgtgagcgcgagctgtttcgcgagctgattcgcctgaatggc
gtggggccgaagctggcgctggcgctgatgtccggcctcgaagtggacgaactggtgcgc
tgcgtgcaggcccaggacgcctcggtactggtgcgtgtgcccggtgtcggcaagaaaacc
gccgagcgcctgctggtcgaactcaaggaccgcttcaaggcatgggaaacctccccggcg
atgttcaccttggtctccgacggtcccttgccggtggccagcgagtcctcggccgaggct
gatgcggtcagcgccctggtctccctgggctacaaaccacaggaggcgagcaaggcgatt
gccgcgatcaaggacaaggctgggctgagcagcgaggagctgatccgtcgcagccttaaa
gggatgattgccaagtga

DBGET integrated database retrieval system