KEGG   Pseudomonas entomophila: PSEEN4191Help
Entry
PSEEN4191         CDS       T00362                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pen  Pseudomonas entomophila
Brite
Enzymes [BR:pen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PSEEN4191 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4471286..4471963)
Genome map
AA seq 225 aa AA seqDB search
MREQDDLMRRGIGMTSQRTRERLIQRLYEEGVSNAKVLEVIRKTPRHLFVDEALAHRAYE
DTALPIGHNQTISQPFMVAHMSELLLEAGPLDKVLEIGTGSGYQTAILAQLVERVFSVER
IKVLQDRAKERLVELNLRNVVFRWGDGCEGWPALAPYNGIIVTAVAPEVPQALLDQLAPG
GRMVIPVGPAGETQQLMLIVREEQGFSRRVLGAVRFVPLLNGPLA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaacaggacgatctgatgcgccgtggcattggcatgacctcccagcgcacgcgg
gagcggttgatccagcgcctgtatgaagagggcgtgtccaacgccaaggtgctcgaggtc
attcgcaaaacgccacgtcacctgttcgtcgacgaggccctggcgcatcgcgcctacgaa
gacaccgcgctgccgatcggccataaccagaccatctcccagcctttcatggtcgcccac
atgagcgagctgttgctcgaagcgggccctctggacaaggtgctggagatcggcaccggc
tccggctaccagaccgcgatcctggcgcagctggtggagcgggtgttctcggtggagcgc
atcaaggtccttcaggaccgtgccaaggagcgcctggtggagctcaacctgcgcaacgta
gtgttccgctggggcgatggttgcgaaggctggccagcgctggcgccctacaacggcatc
atcgtcaccgcagtggcgccggaagtaccccaggcgctgctggaccagctggcgccgggt
gggcgcatggtgatcccggtcgggccggcaggggaaacccagcaactgatgctgatcgtt
cgggaggagcaggggttctcccggcgtgtattgggcgcggtgcgcttcgtgccgttgctc
aacggccccctggcctga

DBGET integrated database retrieval system