KEGG   Pseudomonas entomophila: PSEEN4251Help
Entry
PSEEN4251         CDS       T00362                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pen  Pseudomonas entomophila
Pathway
pen00260  Glycine, serine and threonine metabolism
pen00750  Vitamin B6 metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01230  Biosynthesis of amino acids
Module
pen_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEEN4251 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSEEN4251 (thrC)
Enzymes [BR:pen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSEEN4251 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CAK16938
UniProt: Q1I5Z7
Position
complement(4537669..4539078)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVDGSIADADFKKILEETYGNFAHAAVAPLRQLNGNEWVMELFHGPTLAFKDFALQLLG
RLLDHVLVKRGERVVIVGATSGDTGSAAIEGCRRCDNVDIFILHPHQRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPISQLVVATNRNDILHRFMSGNQYVKDAL
HPTLSPSMDIMVSSNFERLLFDLHGRNGAAVAALMDTFKQGGGFSVEADRWTEARKLFDS
LAVTDEQTCETIAEVFKSTGEVLDPHTAIGVKAARECRRSLDTPMVVLGTAHPVKFPEAV
EKAGVGKALELPAHLSDLFSREERCTVLANDLKTVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacccgcggccaggctccggccctgaacttcgaagacgtcctgctg
gctggcctggccagcgatggcggcctgtacgttcccgagaacctgccacgcttcacccag
gaagagatcgcctcctgggccggcctgccgtaccacgagctggccttccgggtgatgcgc
ccgttcgtcgacggcagcatcgccgacgccgatttcaagaagattctcgaagagacctac
ggcaacttcgcccatgccgccgtcgcgccactgcgtcagctgaacggcaacgagtgggtg
atggaactgttccacggcccgaccctggcgttcaaggatttcgccctgcaactgctcggc
cgcctgctcgaccacgtgctggtcaagcgtggcgagcgcgtggtgatcgtcggcgccacc
agcggtgacaccggctccgccgccatcgaaggctgccgccgttgcgacaacgtcgacatc
ttcatcctgcacccgcaccagcgcgtgtcggaagtgcagcgccggcagatgaccaccatc
ctgggtgacaacatccacaacatcgccatcgagggtaacttcgacgactgccaggagatg
gtcaaggccagtttcgctgaccagtcgttcctcaagggtactcgcctggtagcggtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccacgccgccctgcag
ctgggtggcccggcccgttcggtggcgttctcggtaccgaccggcaacttcggcgacatc
ttcgccggttacctggctcgcaacatgggcctgccgatcagccagctggtggtggcgacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaaccagtacgtcaaggatgccctg
cacccgacgctgtcgccatcgatggacatcatggtctcgtcgaacttcgagcgcctgctg
ttcgacctgcacggccgcaacggcgccgccgtggccgcgttgatggacaccttcaagcaa
ggcggcggcttcagtgtcgaggcagatcgctggaccgaagcccgcaagctgttcgactcg
ctggccgttaccgacgagcagacctgcgaaaccatcgccgaggtgttcaagagcaccggc
gaagtgctcgacccgcacaccgcgatcggcgtcaaggccgcccgtgagtgccgccgcagc
ctggacacaccgatggtggtgctgggcactgcgcacccggtcaagttccccgaagcggtg
gagaaggccggcgttggcaaggccctcgagctgcccgcgcacctcagcgacctgttcagc
cgtgaagaacgctgcacggtgttggccaacgacctgaagactgtccaggccttcgtcagc
cagcacggtaaccgcggcaagcctctgtaa

DBGET integrated database retrieval system