KEGG   Pseudomonas entomophila: PSEEN4253Help
Entry
PSEEN4253         CDS       T00362                                 

Gene name
dsbC
Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pen  Pseudomonas entomophila
Brite
Enzymes [BR:pen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PSEEN4253 (dsbC)
Secretion system [BR:pen02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSEEN4253 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4540517..4541278)
Genome map
AA seq 253 aa AA seqDB search
MRVTQIFAAAALALASTFAAAAATETTAGAEQAIRKSLQNLELEVPVESVASSPLSGLYE
VKLQGGRVLYASADGQFVMQGYLFQIQDGKPVNLTEKTERQGIAKLINGIPAGEMIVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSPGDEQLQAVWCS
SDRRAALDKMVDGKEIKAAKCANPVGKQFALGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAGQQQAAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagattttcgccgccgccgccctggcgctggccagcacctttgccgcc
gccgcggccaccgagacgactgccggcgccgagcaggcgatccgcaagtcgttgcagaac
ctcgagctggaagtgcctgtcgagagcgttgccagcagcccgctcagcggcctttacgaa
gtcaagctgcagggcggccgcgtgctgtatgccagcgccgacggccagttcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgagaagaccgagcgc
caaggcatcgccaagctcatcaacggtattccggcgggcgagatgatcgtctacccggcc
aagggcgagaccaagtcgcacatcaccgtgttcaccgacaccacctgcccgtactgccac
aagctgcatgccgaagtgcccgagctcaaccgtcgcggtatcgaagtgcgctacgtcgcc
ttcccgcgccagggcctgggttcgccgggtgacgagcagttgcaggcggtctggtgttcg
agcgaccgccgcgcggcgctggacaagatggtcgacggcaaagagatcaaggccgccaag
tgcgccaacccggtgggcaagcaattcgccctgggccagtcgatcggtgtcaacggcacg
ccggccatcgtgctcgaaagcggccaggtgatcccgggctaccagccggcaccgcaggtg
gccaagctggccctggccggccagcagcaagcggccaagtaa

DBGET integrated database retrieval system