KEGG   Pseudomonas entomophila: PSEEN4416Help
Entry
PSEEN4416         CDS       T00362                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pen  Pseudomonas entomophila
Pathway
pen00010  Glycolysis / Gluconeogenesis
pen00052  Galactose metabolism
pen00500  Starch and sucrose metabolism
pen00520  Amino sugar and nucleotide sugar metabolism
pen00521  Streptomycin biosynthesis
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
Module
pen_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN4416 (glk)
   00052 Galactose metabolism
    PSEEN4416 (glk)
   00500 Starch and sucrose metabolism
    PSEEN4416 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSEEN4416 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSEEN4416 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PSEEN4416 (glk)
Enzymes [BR:pen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSEEN4416 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: CAK17100
UniProt: Q1I5I5
Position
complement(4720118..4721074)
Genome map
AA seq 318 aa AA seqDB search
MKALLVGDIGGTNARFALWRNNELHAVQVLATADFTSPEQAIEAYLADQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRSAFCQTLQVERLLLINDFSAMALGMTRLRDGEFHEVC
AGQADPSRPALVIGPGTGLGVGSLLRLGEHWLALPGEGGHVDLPVGNAREAAIHQEIHRQ
IGHVSAETVLSGGGLVRLYQAICALDGATPTHKTPAQITDAALAGEPRALAVIEQFCRFL
GRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFAGVPVWLVTA
EFSGLLGAGVALQQSLDR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctgctggttggcgatatcggcggtaccaacgcacgttttgccttgtggcga
aacaatgaactgcacgcggtccaggtcctggcgaccgccgactttaccagccccgagcag
gccatcgaagcctacctcgccgaccagggcatcgcccgtggcggcctggcggcggtgtgc
ctggcggtggccgggccggtggacggcgacgaattccgtttcaccaacaaccactggcgg
ctgagccgcagcgccttctgccagacactgcaggtcgagcgcctgctgttgatcaacgat
ttctccgccatggccctgggcatgacccggctgcgtgacggcgagttccacgaggtttgc
gccggccaggccgacccgtcgcgtccggcgctggtgatcgggcctggcaccggcctgggc
gtgggcagcctgctgcgcctgggcgagcactggctggcgctgccgggcgagggtgggcat
gtcgacctgccggtgggcaatgcccgcgaggcggcgatccaccaggagattcatcggcag
atcggtcatgtcagcgccgaaaccgtgctcagtggtggcgggctggtgcggctgtaccag
gccatctgcgcgctcgatggcgccacgccgacgcacaagacgccggcgcagatcaccgac
gcggccctggccggcgagcctagggcgttggcggtgatcgagcagttctgccgattcctc
gggcgggtggcgggcaacaatgtgctcaccctcggcgcccggggaggtgtctatatcgtc
ggtggggtgattccccgtttcgccgagttgttcctgcgcagtggttttgccgcgagtttt
gccgacaagggctgcatgagcgggtatttcgccggggtgccggtgtggctggtgacggcg
gagttttccgggttgctgggggcgggggtggctctgcagcaatcactggatcgctga

DBGET integrated database retrieval system