KEGG   Pseudomonas entomophila: PSEEN4444Help
Entry
PSEEN4444         CDS       T00362                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pen  Pseudomonas entomophila
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSEEN4444 (holC)
   00240 Pyrimidine metabolism
    PSEEN4444 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PSEEN4444 (holC)
   03430 Mismatch repair
    PSEEN4444 (holC)
   03440 Homologous recombination
    PSEEN4444 (holC)
Enzymes [BR:pen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PSEEN4444 (holC)
DNA replication proteins [BR:pen03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PSEEN4444 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4757099..4757527
Genome map
AA seq 142 aa AA seqDB search
MSQVDFYILPTDSLSARLDFACKLCEKAWRLGHRVYLHCQDEAQRLDLDERLWRFKGEAF
IPHNHAETHQDASVALGLGNDAGEHRDLLINLGGDVPGFVGQFERVAEIVVEEPTIRLAA
RERFRFYREQGYALQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtcgatttctacatcctgcccaccgactcgctgtcggcgcggctggatttc
gcctgcaaactctgcgagaaagcctggcgcctggggcaccgggtctacctgcactgtcag
gacgaggcccagcgcctcgacctggacgagcgcctgtggcggttcaagggtgaagccttc
atcccccacaaccacgccgaaacgcaccaggatgccagcgtcgcccttgggctcggcaac
gacgccggtgagcaccgcgacctgctgatcaacctgggcggcgacgtccctgggttcgtc
ggccagttcgaacgggtcgccgagatcgtcgtggaggagccgaccatccgcctggccgca
cgcgagcgattccgtttctaccgcgaacagggctatgctctgcaagaccaccgcttacag
cgactttga

DBGET integrated database retrieval system