KEGG   Pseudomonas entomophila: PSEEN5127Help
Entry
PSEEN5127         CDS       T00362                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pen  Pseudomonas entomophila
Pathway
pen00620  Pyruvate metabolism
pen00630  Glyoxylate and dicarboxylate metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01200  Carbon metabolism
Module
pen_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSEEN5127 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSEEN5127 (glcB)
Enzymes [BR:pen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSEEN5127 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CAK17756
UniProt: Q1I3N0
Position
5442970..5445147
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKVLFDFVNNEAIPGTGINAEQFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQAHKGQAHDAVAYKVFLQEIGYLLPQAEDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKLRGDKVIAFARAFLDQAA
PLAAGSHVDSTAYRIEGGKLVVALKGGSNSGLRDDAQLIGFHGDAKAPTAVLLKHNGLHF
EIQVDATTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVDADDKVVVYRNWLGLMKGDL
AESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMHGPEEVAFAAEIFSRVEDLLGM
KRNTVKVGIMDEERRTTVNLKACIKSAAERVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDIGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILTIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISAQLLANWLRHGVVTQEQVLESL
KRMAAVVDKQNAGDIQYRPMAPNFDDNIAFQAAIELVVEGAKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggtcctgttcgacttcgtc
aacaacgaagccattccggggaccggcatcaacgccgagcagttctgggccggtgccgag
aagatcatcaacgacctcgctcccaagaacaaagccctgctcgccaagcgcgacgagctg
caagcgaagatcgacgcctggcaccaggcacacaagggccaggcccacgacgccgtggca
tacaaggtcttcctccaggaaatcggctacctgctgccgcaggccgaagacttccaggcc
accacccagaacgtcgacgaagaaatcgcccacatggccggcccgcagctggtggtgccg
gtgatgaacgcccgcttcgctttgaacgccgccaacgcccgctggggttcgctgtacgat
gccctgtacggcaccgacgccatcagcgatgaaggcggcgccgaaaaaggccaggggtac
aacaagctgcgcggcgacaaggtcatcgccttcgcccgtgccttcctcgaccaagccgcg
ccactggccgccggctcccacgtcgactccaccgcctaccgcatcgaaggcggcaagctg
gtggtcgccctcaagggcggcagcaacagcggcctgcgcgacgacgcccagttgatcggc
ttccatggcgatgccaaggccccgaccgccgtgctgctcaagcacaacggcctgcacttc
gagatccaggtcgacgccaccaccccggtcggcagcaccgacgccgcgggcgtgaaagac
atcctgatggaatcggcactgaccaccatcatggactgcgaagactcggtcgccgccgtc
gacgccgacgacaaagtggtcgtctaccgcaactggctgggcctgatgaaaggcgacctg
gccgagagcgtgagcaagggcggcaagaccttcacccgcaccatgaacccggaccgcgag
tacgccgcccctaacggcggcagcgtcaccctgcacggtcgttcactgctgttcgtacgc
aacgtcggtcacctgatgaccaacccggcgatcctcgacgcccagggtaacgagattccg
gagggtatccaggatggtctgttcaccaacctgatcgccctgcacaacctcaacggcaac
accagccgcaagaacacccgcagcggcagcgtgtacatcgtcaaaccgaaaatgcacggc
cctgaagaggtggccttcgccgccgagatcttcagccgcgtcgaagacctgctgggcatg
aagcgcaacaccgtcaaggtcggcatcatggatgaggaacgccgcaccacggtcaacctc
aaggcctgcatcaagtcggccgccgagcgcgtggtgttcatcaacaccggcttcctcgac
cgtaccggtgacgagatccacacctccatggaagccggcgccgtggtgcgcaagggcgcc
atgaagaacgagaagtggatcggcgcctacgagaacaacaacgtcgacatcggcctggcc
accggcctgcaaggccgcgcgcagatcggcaagggcatgtgggccatgccggacctgatg
gccgccatgcttgaacagaagatcgcccacccgctggccggcgccaacaccgcctgggtg
ccatcgccgaccgccgccaccctgcacgccctgcactaccacaaggtcgacgtgcaggcg
cgccagcgcgagctggcttcgcgtaccccggcgtcggtcgacgacatcctgaccatcccg
ctggctgccgacaccaactggtccgcagaagagatccgcaacgaactggacaacaacgcc
cagggcatcctcggttacgtggtgcgctggatcgaccagggcgtgggctgctcgaaggtg
ccggacatcaacgatgtcggcctgatggaagaccgcgccaccctgcggatctcggcacag
ttgctggccaactggctgcgccatggcgtggtcacccaggaacaggtgctggaaagcctc
aagcgcatggccgcggtggtggacaagcagaacgccggtgacatccagtatcgcccgatg
gcgccgaacttcgatgacaacatcgcgttccaggccgctatcgagttggtggtcgagggc
gccaagcaaccaaacggctataccgagccggtgctgcaccgtcgtcgtcgcgagttcaag
gcgcgtaacgggttgtaa

DBGET integrated database retrieval system