KEGG   Pseudomonas entomophila: PSEEN5146Help
Entry
PSEEN5146         CDS       T00362                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide S-acetyltransferase, E2 component of the pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pen  Pseudomonas entomophila
Pathway
pen00010  Glycolysis / Gluconeogenesis
pen00020  Citrate cycle (TCA cycle)
pen00620  Pyruvate metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01120  Microbial metabolism in diverse environments
pen01130  Biosynthesis of antibiotics
pen01200  Carbon metabolism
Module
pen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN5146 (aceF)
   00020 Citrate cycle (TCA cycle)
    PSEEN5146 (aceF)
   00620 Pyruvate metabolism
    PSEEN5146 (aceF)
Enzymes [BR:pen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSEEN5146 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H PYNP_C HlyD_D23 RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAK17774
UniProt: Q1I3L2
Position
5467611..5469242
Genome map
AA seq 543 aa AA seqDB search
MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASMEIPAPKAGVVKELKVK
LGDRLKEGDELLVLEVEGAAAAPEAPAAAAPAPAAAPAPAAEAAPAPAAAPAAASVQDIH
VPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPSPSAGVIEAVLCKLEDEV
GTGDLIFKIKAAGAAPAAAPAPAASAPAAAPAQAAAPAAAPAPAAAPAPAATAPAAGSNA
KVHAGPAVRQLAREFGVDLGAVAATGPHGRILKEDVQVYVKAMMQKAKEAPAAGATGGAG
IPPIPAVDFSKFGEVEEVALTRLMQVGAANLHRSWLNVPHVTQFDSADITELEAFRVAQK
AVAEKAGVKLTVLPLLLKACAFLLKELPDFNSSLAPSGKAIIRKKYVHIGFAVDTPDGLL
VPVIKNVDQKSLLQLAAEAAALAEKARTKKLSADDMQGACFTISSLGHIGGTGFTPIVNA
PEVAILGVSKATMQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLGDVLADIRT
MLL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaaatcatcgagctg
ttcgtcaaggtcggtgaccgtatcgaagcagaccagagcctgctgaccctggagtccgac
aaggcctccatggaaatcccggcccccaaggccggcgtggtcaaggagctgaaggtcaag
ctgggcgaccgcctgaaagaaggcgacgagctgctggtcctggaagtcgagggcgccgct
gcggcgcctgaggctccggccgctgccgccccggctccggctgctgccccagcaccggct
gccgaagcggcccctgcgcctgccgcagccccggctgccgccagcgtgcaagacatccac
gtgccggatatcggttcgtcgggcaaggccaagatcatcgaagtgctggtcaaggtcggc
gacaccgtcgaagccgaccagtcgctgatcaccctggagtccgacaaggcttccatggag
atcccgtcgcctagcgccggcgtgatcgaagccgtgctgtgcaagctggaagacgaagtg
ggcaccggtgacctgatcttcaagatcaaggccgctggcgccgcccctgccgcagcgccg
gctccggccgcttctgctccggctgccgctcctgcccaagccgctgcgcctgccgctgct
ccggcgcctgctgccgcccctgctccggccgccaccgcgccggcagccggcagcaatgcc
aaggttcatgctggccctgccgttcgtcagctggcccgtgaattcggcgtcgacctgggt
gccgtcgcggccactggcccgcacggtcgtatcctcaaggaagacgtgcaggtctacgtc
aaggccatgatgcagaaggccaaggaagccccggccgccggtgctaccggtggtgctggc
atcccgccgatcccggccgtggacttcagcaagttcggtgaagtggaagaggtcgccctg
acccgcctgatgcaggtcggcgccgccaacctgcaccgcagctggctgaacgtgccgcac
gtcacccagttcgactccgccgacatcaccgagctggaagccttccgcgtcgcgcagaaa
gctgtcgcggagaaggccggcgtcaagctgaccgtgctgccgctgctgctcaaggcctgc
gccttcctgctcaaggaactgccggacttcaacagctcgctggcaccaagcggcaaggcg
atcatccgcaagaagtacgtgcacatcggcttcgccgtggacaccccggatggcctgctg
gtccctgtgatcaagaacgtcgaccagaagagcctgctgcaactggctgccgaagccgcc
gcgctggccgagaaagcccgcaccaagaagctctcggccgacgacatgcagggcgcctgc
ttcaccatctccagcctcggccacattggcggcaccggcttcacgccgatcgtcaacgcg
cctgaggtggcgatcctgggcgtatcgaaagcgaccatgcagccggtctgggatggcaag
gccttccagccgaagctgatgctgccgctgtcgctgtcctacgatcaccgcgtgatcaac
ggcgccgccgccgcgcgcttcaccaagcgcctgggcgacgtgctggcggatatccgcacg
atgctgctgtaa

DBGET integrated database retrieval system