KEGG   Pseudomonas entomophila: PSEEN5434Help
Entry
PSEEN5434         CDS       T00362                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pen  Pseudomonas entomophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEEN5434 (algC)
   00030 Pentose phosphate pathway
    PSEEN5434 (algC)
   00051 Fructose and mannose metabolism
    PSEEN5434 (algC)
   00052 Galactose metabolism
    PSEEN5434 (algC)
   00500 Starch and sucrose metabolism
    PSEEN5434 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PSEEN5434 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PSEEN5434 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSEEN5434 (algC)
Enzymes [BR:pen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSEEN5434 (algC)
    5.4.2.8  phosphomannomutase
     PSEEN5434 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5752836..5754233
Genome map
AA seq 465 aa AA seqDB search
MNDMAHLVPALPDSIFRAYDIRGVVGKNLHAETAYWIGRAIGAQTLAQGEPQISVGRDGR
LSGPMLVEQLIKGLADAGCQVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFK
IVIAGDTLANEQIQALLTRLKTNDLTRGEGRVQKVEILDRYFQQINSDVKLAKRLKVVVD
CGNGAAGVVAPQLIEALGCDVIPLFCEVDGHFPNHHPDPGKPENLEDLIAKVKETGADIG
LAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQHG
GRALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKAGQ
DAETLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGVANLTTIDGVRVDYPHGWG
LVRASNTTPVLVLRFEADSAAELDRIKAVFRTQLLRVQPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggcccacctggtacccgcactacccgacagcatcttccgcgcctatgac
atccgtggcgtggtcggcaagaacctgcacgccgaaaccgcctactggatcggccgcgcc
atcggcgcccagaccctcgcccagggcgagccgcagatctcggtgggccgcgacggccgc
ctgtccggcccgatgctggtcgagcaactgatcaagggcctggccgacgccggttgccag
gtcagcgacgtcggcctggtaccgacgccagcgctgtactacgccgccaacgtgctggcc
ggcaagtcgggggtgatgctcaccggcagccacaacccgtctgactacaacggtttcaag
atcgtcatcgccggcgacaccctggccaacgaacagatccaggccctgctgacgcgcctg
aagaccaacgacctgacccgcggcgaaggccgggtgcagaaggtcgagatcctcgaccgc
tacttccagcagatcaacagcgacgtgaagttggccaagcgcctgaaggtggtggtcgac
tgtggcaacggcgccgccggcgtggtcgccccgcagctgatcgaagccctgggctgcgac
gtgatcccgctgttctgcgaggtcgacggccacttccccaaccaccatccggacccgggc
aagcccgagaacctggaagacctgatcgccaaggtgaaggaaaccggcgccgatatcggc
ctggccttcgacggcgacggcgaccgcgtgggcgtggtgaccaacactggcagcatcgtc
taccccgaccgcctgctgatgctgttcgcccaggacgtgctgtcgcgcaaccctggcgcc
gagatcatcttcgacgtgaaatgcacccgccgcctcaccccgctgatcgagcagcacggc
ggccgcgcgctaatgtggaagaccggccattcgttgatcaagaagaagatgaagcagacc
ggctcgttgctggccggcgagatgagcgggcacatcttcatcaaggaacgctggtacggt
ttcgacgacggtatctacagtgccgcgcgcctgctggagatcctcagcaaggccggccag
gacgccgaaaccctgttcgccgccttccccaatgatatttccacgccggaaatcaacatt
gatgtgaccgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgactgg
ggcgtggccaacctgaccaccatcgacggtgtgcgggtcgactacccacacggctggggc
ctggtccgcgcctccaacaccacaccggtgctggtgctgcgcttcgaggccgacagcgcg
gcagaactcgaccgaatcaaggctgtattccgcacgcagttgctgcgagtccaaccagac
ctgcaactgccgttctga

DBGET integrated database retrieval system