GenomeNet

Database: Pfam
Entry: P3A
LinkDB: P3A
Original site: P3A 
#=GF ID   P3A
#=GF AC   PF08727.8
#=GF DE   Poliovirus 3A protein like
#=GF AU   Mistry J
#=GF SE   pdb_1ng7
#=GF GA   22.30 22.30;
#=GF TC   23.50 94.90;
#=GF NC   20.60 19.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   12823963
#=GF RT   Towards an understanding of the poliovirus replication complex:
#=GF RT   the solution structure of the soluble domain of the poliovirus
#=GF RT   3A protein. 
#=GF RA   Strauss DM, Glustrom LW, Wuttke DS; 
#=GF RL   J Mol Biol. 2003;330:225-234.
#=GF DR   INTERPRO; IPR014838;
#=GF DR   SCOP; 1ng7; sf;
#=GF CC   This domain is found in positive-strand RNA viruses.  The 3A
#=GF CC   protein is a critical component of the poliovirus replication
#=GF CC   complex, and is also an inhibitor of host cell ER to Golgi
#=GF CC   transport.
#=GF SQ   2
#=GS POLG_HRV8A/1421-1472  AC P07210.3
#=GS POLG_POL1M/1457-1515  AC P03300.3
#=GS POLG_POL1M/1457-1515  DR PDB; 1NG7 A; 2-60;
#=GS POLG_POL1M/1457-1515  DR PDB; 1NG7 B; 2-60;
POLG_HRV8A/1421-1472             AIFQGIDLQ-----SPPPPAIADLLRSVKTPEIIKYCQDNNWIV--PAECSIERDLGIA
POLG_POL1M/1457-1515             GPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA
#=GR POLG_POL1M/1457-1515  SS    -SS--SS-S--SSS--SS-TTHHHHHHH--HHHHHHHHHHT--TT-SSS--SSSS-S--
#=GC SS_cons                     -SS--SS-S--SSS--SS-TTHHHHHHH--HHHHHHHHHHT--TT-SSS--SSSS-S--
#=GC seq_cons                    u.hQhhDLp.....SPPP.sIsDLLpuVco.ElhcYCpcpsWIV..supsphERslshA
//
DBGET integrated database retrieval system