KEGG   Plasmodium falciparum 3D7: MAL13P1.14Help
Entry
MAL13P1.14        CDS       T00095                                 

Definition
ATP dependent DEAD-box helicase, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:join(145376..149520,149701..150126,150271..150400)
Genome map
AA seq 1566 aa AA seqDB search
MTKGNAILIDDINTTFIKDDEEKKEMVQANDGSSSSTPVSFNEPNKLSNKEKKKLEYQKR
IQRKKEKQLKKVQKLITKTQSGSLSYLKNNIASSSVFNKLVDQKKEQNKNNIKNNYIENE
AIGNKNNDVNLNNNDINVKNNDLNIMNSDNINNTNDIYNNSNNKKKKKNKIKNINKNTAD
NSSESSHEEQNGKSDLYCALENISKKKLIKKLKNKNKHEKEIEKKKLFKKIQEFKLNNTE
QKNLMIPFDIKAVPKNTEHLDKLLKTYEELNIELPHYLNIIKKKIEKKRKRFLDKMEYLK
EEKNVQLTESIKSKEVDGDVKKKKNKINSLKEESESYIETNSINETYTDQCNIIIKSESS
DEDYNKMEPHGSYDDSDMDHENISSYHNSTKEKKNDINGINGINHINGINDINGINNNNN
NNNNNSYNNAYNKDKRKVCYKNVQVNRKEHIDKVRASLPVLDYEQELIEAVLNYDVVFVN
GDTGCGKSTQVPQFLYEYGFTSNDYFIGITQPRKIAVKSICNRLNDELNEEICGYQIRFE
KSYFLKHSKIKVMTEGILLKEIMSDFILSKYSVIILDEAHERSINMDIIIGILSIISKIR
NDNYYNFKSDIIPIKIIIMSATINDNNLFQNKIFQNFTTVNIPTQKVQVIDHFLSYTPKD
YVEEAKRKIIQIHKKLPQGSILVFLTSQEEIYRLYNMLSNLKITNSEFNQQGENKIMDEV
NFDIFDLSEGEQNKDEKVSLFFRETDENEEKKILFDVSEEENSVESDIKESDIKESDYIK
EGDIKESDYIKESNIEESNIDESNIEESDIEESDVKESDVKESDIKESDIKESDNDVYDK
ELHDDDHMDDEPKKSNINTYELNNNTKKKSSIWKGSDGSGTLKVFKLYSKLPMKDQMELF
HNPKENERVCILSTNIAETSLTLPNIRYVIDCGKEKRKIYSNLNDYSYYIIDNISKCSAI
QRKGRAGRILYLLKKNKKNKKKMENEKGHVYKLYSSNYYNYFFKNDNDYPILNYPLDSLI
LYLLSFNIKNVENFPFINKPDKSKFIEAKKRLIYLNCIHFVYKDIEFLFKQIDQKRCLKS
SIENHIKKFNPYNKKGGITLTGSFILLLPISTRYAKILTDVCLKSLAMKQLNTIPLAALL
VSCLYLESIFSYDYKLKMKYKKKKTTKKDKNVNMTIHQNKEENKPKNHNNLINLFLVNKK
KQKHTYTSSDDDDDDDNNTLSSSNNDMSEEHIHHIKNNINVDVLENFKEQFDNDILFYLN
ICTKFYFSKDRNETCQIMHLDKKKMNELLKLSNHLIKIINYKLNTNISLDMLQENISDIS
KNIIHYAVIQGFIDHLAIRSDLVHNQYTRNQNITYNSKKAYITQNMNMPIYINSSSVLYQ
NRPYPKYILYNYITKNRNSYVMFDCLKIDDAELGNITNVCIFINEYEKIPPAKYDKDNDK
IIVYVKPLYLPSSHYLSITYKELNEKDLLFYNYFALFLLDGSMFLKMTKFQMYYSHTTYD
VINSAQENIKNFIEALKNAQINNRSSLIAKWKEDRDFLKNEFLSLIVKKFNKNQNDFFNN
IWPPLD
NT seq 4701 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggaaatgcaatattgatagatgatattaatacgacttttattaaagatgac
gaagaaaaaaaagaaatggtccaagcaaatgacggttcaagttcttcaacaccagtctct
tttaatgaacctaacaaattaagtaataaagaaaaaaagaaattagaatatcaaaaaaga
atacaaagaaaaaaagaaaaacaactcaaaaaagttcagaaactaattacaaaaacacaa
tcaggatcgctaagttatttgaagaataatattgctagttcgtccgtatttaataaatta
gtagatcaaaaaaaggaacagaacaaaaataatattaaaaataattatatagaaaatgaa
gctattggaaacaaaaataatgatgtaaatttaaacaataatgatataaatgtaaaaaat
aatgacctaaatattatgaatagtgataatataaataatacaaatgatatatataataat
agtaataataaaaagaagaaaaaaaacaaaattaaaaatataaacaagaacacagcagac
aattcttctgaatcgtcacatgaagaacaaaacggcaaaagtgatttgtactgtgcccta
gaaaatatatcaaaaaaaaaactcatcaaaaaattaaaaaataaaaataaacatgagaag
gaaattgaaaaaaaaaagctattcaagaaaatacaagaattcaaattaaataatacagaa
caaaaaaatttaatgataccatttgatataaaagcggtaccaaaaaatacagaacattta
gataaacttctaaaaacatacgaagaattaaatattgaattaccacattatttaaacata
atcaaaaagaagatagagaaaaaaaggaaacgatttcttgacaaaatggaatacctaaag
gaagaaaaaaatgtacaactaaccgaaagtattaaaagtaaagaagtagatggtgatgta
aaaaaaaaaaaaaataaaattaatagtcttaaagaagagtcagaaagttatatagaaaca
aatagtatcaatgaaacgtatacggatcaatgtaatattattataaaatctgaatctagt
gatgaggactataacaaaatggagcctcatggttcttacgatgacagtgacatggatcat
gagaatatttcctcatatcacaacagtacaaaggaaaaaaaaaatgacataaatggtata
aatggtataaatcatataaatggtataaatgatataaatggtataaataataacaacaac
aataataataataattcatataataatgcttataataaggataaaagaaaagtgtgctat
aaaaatgtacaggtgaaccgcaaagaacatattgataaagttagggcatctcttccagta
ttagattatgaacaagaacttatagaagctgtcttaaattatgatgtagtttttgttaat
ggagatactggttgtgggaaatcaacccaagtacctcaatttttatatgaatatggtttt
acatcaaatgattattttattggtattactcaaccaagaaaaatagctgtaaaaagtatt
tgtaatagattaaacgatgaactaaatgaagaaatatgtggttatcaaattaggtttgaa
aaatcgtattttttaaaacatagtaaaattaaagttatgacagaaggaattttattgaaa
gaaattatgagtgattttattttatcaaaatatagtgttattattcttgatgaagcacat
gaaagaagtataaatatggatataattataggaattttgtcaataatttctaaaattaga
aacgataattattataattttaaatcagatattattcctatcaaaattataataatgtct
gcaactattaatgataataatctttttcaaaataaaattttccaaaattttactactgtc
aatattccaacacaaaaggtacaagttatagatcatttcctttcctatacacctaaggat
tatgttgaagaagcaaaaagaaaaattattcagatacataaaaaacttccacagggaagt
attttagttttcttaacaagccaagaagaaatatatcgtctctataatatgttatcaaat
ttaaaaataactaattcggaattcaaccaacaaggagaaaataaaattatggatgaagtc
aattttgacatatttgatttaagtgaaggagagcaaaataaggatgaaaaggtcagtttg
ttttttagagaaactgatgaaaatgaagagaaaaaaattttgtttgacgtgtcggaggaa
gagaatagtgtggaaagtgatataaaggaaagtgatataaaggaaagtgattatataaag
gaaggcgatataaaggaaagtgattatataaaggaaagcaatatagaagaaagcaatata
gatgaaagcaatatagaagaaagcgatatagaagaaagcgatgtaaaagaaagcgatgta
aaagaaagcgatataaaagaaagcgatataaaagaaagcgataatgatgtatacgataaa
gaactacatgatgacgaccatatggatgatgaaccaaaaaagagtaatataaatacgtac
gaattaaataataatacaaaaaaaaaatcaagcatatggaaaggaagcgatggttcaggt
accctaaaagtttttaaactttattcaaaattacccatgaaagatcaaatggaattattt
cataacccgaaagaaaatgaacgtgtatgtattttaagtacaaatattgctgagacatca
cttacattaccaaatatacgctacgtaattgattgtggtaaagaaaaaagaaaaatatat
tctaatttgaatgattattcttattatattattgacaatatcagtaaatgctcagctata
caaagaaaaggtagagctggtagaattttatatttattaaaaaaaaataaaaagaataaa
aaaaaaatggaaaatgaaaaaggacatgtgtataaattatattcatcaaattattataac
tatttttttaaaaatgataatgattatccaatattaaattatcctctagattctttaata
ttatatttattaagttttaatataaaaaatgttgagaacttcccttttattaataaaccg
gataaatccaaatttattgaagcaaaaaaaagattaatatatcttaattgtattcatttt
gtatataaagatattgaattcctttttaaacaaattgatcaaaaaagatgtttaaaaagt
agtatagaaaatcacatcaaaaaatttaatccatataataaaaaaggaggaattacatta
acaggaagttttatattattattaccaataagtactagatatgctaaaatattaacagat
gtctgtttaaaatcattagctatgaaacaacttaataccatacctctagcagcattatta
gtatcctgtttataccttgaatccattttttcatatgattataaacttaaaatgaaatat
aaaaaaaaaaaaacaacaaagaaagataaaaatgtaaatatgacaattcatcagaataaa
gaagaaaacaaaccaaaaaatcataacaacttgataaacttatttttagtaaacaaaaaa
aagcaaaaacatacatatacatctagtgatgatgatgatgatgatgataataatactttg
tcaagttcaaataatgatatgtctgaagaacatatacatcatatcaaaaataacatcaat
gttgatgtgctagaaaattttaaagaacaatttgataatgatatacttttttatttaaat
atttgtacaaaattttatttttcaaaagatagaaatgaaacatgtcaaattatgcatctt
gataaaaaaaaaatgaatgaattgttaaaattatcaaatcatctaataaaaattataaat
tataaattaaatacaaatatttctttagatatgttacaagaaaatatttccgatatctcc
aaaaatattattcattatgcagtcatacaaggatttattgatcatctggcaatccgttca
gatcttgttcataatcaatatacaagaaatcaaaatattacatataatagtaaaaaagca
tatataacacaaaatatgaatatgcccatatatataaattcaagctctgtattatatcaa
aacagaccttatcctaaatacatcctgtacaactacattacgaaaaatagaaactcctat
gttatgtttgactgcttgaaaatagacgatgcagaattaggaaatatcacaaatgtttgt
atctttataaatgaatatgaaaaaatccctccagcaaaatatgataaagataatgataaa
attatagtgtatgtaaaaccattatatctaccttcatctcattacttatccataacatat
aaagaattaaatgaaaaagatttgcttttttataattattttgcattatttttattagat
ggatccatgtttttaaaaatgacaaaatttcaaatgtattattcacatacgacctacgat
gtaattaattcggcgcaagaaaatattaaaaactttattgaagccttaaaaaacgcccaa
ataaataatagatcttccttaatagccaagtggaaggaggatagagactttcttaagaac
gaatttttatcgttgattgtaaaaaaatttaataaaaatcaaaatgatttttttaataat
atttggccacccttggattaa

DBGET integrated database retrieval system