KEGG   Plasmodium falciparum 3D7: MAL13P1.166Help
Entry
MAL13P1.166       CDS       T00095                                 

Definition
DEAD box helicase, putative
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MAL13P1.166
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     MAL13P1.166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:complement(join(1300104..1300173,1300314..1300412,1300605..1300718,1300918..1301140,1301265..1303074,1303336..1304416,1304615..1304744,1304950..1305010,1305214..1305295,1305428..1305492))
Genome map
AA seq 1244 aa AA seqDB search
MFEKKKKKVKNKNSIHLQCYRRLGIHRKKYFNFSNQLIYISLSGHIYTYPSYEGVLQADK
YILDELCITKFGESSAITDIKLLYKKIYKNDYDPSKYTKQNFEHYYIPPSIIKAYNELGI
HKLYKEQAECLCKIFLNDDIENKIKNGIYMNHGNNEEFVSNENTHCKSNVEVNTDISMNL
DFFCDMNIVDMKNIKYTPGKKEDIQIDEFTDLIKSDITFGKKKNVDICNHMDNKMKVYTN
EYTNEYTNEYTNEYTNEYTNEYTNECSNEDTNEYNLNNSHSKYDTLVNVENSSYKKRSQI
CYWSNNNNNNNNKFYNNFLFKIPTGMGKTLIYDILIIRQVLYKGFRVILTLPTLSLINEK
YEYYDKLFGDQTVSLNIKKFNSNDFTGYSYSLSTDLALCTFEQANTILSIIIKNNLKFNY
LFILDEIHYINNQKRGFHIESLLTKIKYIQKNFSHIYNIKVYGFSATISNIDQLAEWLDA
NVYESKTKLQRIKYLYKIDNSLYKDINKNEVERTLENCNTLDPNHLGYLISEEFILKKNV
LIFCPSKNKSEQTASFISSTLPYYLNKRDYKINMELQEKRFKLLNDLKGLTIKVANVEKM
IMNGIFYHHSGLNINEKSLIENSFRNNILFCLCCTTTLSVGINMNIHTIIIRSLKLGKSF
ITKDEITQMAGRCGRSQKKLYDSTSSCKNFDESTNKSYMTPDRRYTDSSGLPPILDYDYD
CDGKVIIFVSNVEKHYLEKILYDEEEMSKLKTTLNNIQMCKFLLDFIHLKLIKTKKDMFD
FLYLYSIKFFKAKRVEGNTNDDDQNNGINMNINNNDKCIHNNNDKCCSNNNNNDKCCSNN
NNNDKCCIHNNNDKCINNNNDKCINNNNDKCIHNNNDKCCIHNNNKCSNNMNEKILIDVK
QTFQYLFENKLITIPYEQEKNYYEHVFNKIFHINFCDINKIFTFQYINQNINPNILMKYN
ITQKINIFKKLYHNYKGKNITTDKQTSFFTLPFITILLIFKDIEFNKNLFQNLYVEFIKY
IFLMNINLQQYDLFVYDILKDDDPIACTELFSYVQSASSIMEFIFNYSLVQYIYVKGFLP
DVLLMIFAFCINSEINLKIHFDIYEQILMSHNKNIKNVFQFFGLNVEKLKNFELKNVDDL
FDASANILKGKLNIDQIYENLEWIKIKRFYYAMIIYDCYNDDVYQVAKKYRLKLKEIKTV
YLRCIFNLSYNCRILKNFKNSLDIFCIILENLLAKMKTKNFPFI
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaaaaaaaaaaaaaaaagtaaaaaataaaaattcgattcatttacaatgttat
cgaagattaggtattcatcgaaaaaaatatttcaatttttcaaatcagttgatatacatt
tctttgtctggccatatttatacatacccaagttatgaaggggtgttacaggcagacaaa
tatattctcgatgaattgtgcataacaaaatttggggaaagctctgcaattactgatata
aaattattatacaaaaaaatatacaaaaatgattacgatccttctaaatatactaaacaa
aactttgaacactattacataccaccttcaattattaaagcatataacgaactaggtata
cacaaactatataaagaacaagcagagtgtctttgtaaaatatttttaaatgacgatata
gaaaataaaataaaaaatggaatttatatgaaccatggaaataacgaggaatttgtatca
aatgaaaacacgcattgtaaaagtaatgtagaagtaaatacagatatttcaatgaattta
gattttttttgtgatatgaatattgtagatatgaaaaatataaaatacacacctgggaaa
aaagaagatatacaaattgacgaatttacagatttgattaaaagcgatataacatttggt
aagaagaaaaatgtggatatttgtaaccacatggataataaaatgaaggtatatacaaac
gaatatacaaacgaatatacaaacgaatatacaaatgaatatacaaacgaatatacaaat
gaatatacaaacgaatgttctaatgaagataccaacgaatacaatcttaataacagccat
tctaaatatgatacacttgttaatgttgaaaattcatcatataaaaaaaggtcgcagata
tgttactggagtaataataataataataataataataaattttataacaatttcctattt
aaaatacctacaggtatgggaaaaacattaatttatgatattcttattattcgtcaagtt
ttatataaaggttttagagttattttaaccttaccaacattatctctaataaatgaaaaa
tatgaatattatgataaattatttggtgatcaaacagtatcattaaatattaaaaaattt
aatagtaatgattttaccggatattcatatagtctatcaacagatttggcattatgcaca
tttgaacaagcaaacaccattttaagtattatcattaaaaataatttaaaatttaattat
ttatttatacttgatgaaattcattatataaataatcaaaagaggggatttcatattgaa
tccctcttaacaaaaattaaatatatccagaaaaattttagtcatatttataatataaag
gtatatggcttttctgcgactatttccaacattgaccagctagctgaatggctagacgcc
aatgtgtatgaaagcaaaacgaaacttcaacgaataaaatacctgtataaaatagacaac
tcattatacaaagatataaacaaaaacgaggtggagaggacgttggaaaattgtaatacg
ttggatccgaatcatttgggatatttgataagtgaagaatttattttaaaaaagaatgtt
ttaatattttgtccatcgaaaaataagagtgaacagacggcttcatttataagtagtaca
ctgccttattatttgaataagagagactataaaataaatatggaattacaagaaaagcgg
tttaaattattaaatgatttgaaaggtttgacaataaaagtagcaaatgttgaaaagatg
attatgaatgggatattttatcatcattcaggattaaatattaatgagaagagtcttatt
gaaaattcttttcgaaataatatattattttgtttgtgttgtacaacaacattatctgta
ggaataaatatgaatattcatactataataattcgtagtttgaaattaggaaaatcattt
ataacaaaagatgaaatcacacagatggcaggacgatgtggaagatctcagaaaaaattg
tatgatagtacttcaagttgtaaaaatttcgatgaaagtacaaataaaagttatatgaca
cctgatagaagatatactgattcaagtggcttacctcctatattagattatgattatgat
tgtgatgggaaagttataatatttgtgtccaatgtagaaaaacattatttagaaaaaata
ttatatgacgaagaagaaatgtctaaattaaaaactacattaaataatatccaaatgtgt
aagtttttattagattttattcatttaaaattaataaagacaaaaaaagacatgtttgat
tttttatatttatatagcatcaaattttttaaggcaaaacgtgtagaaggcaacacaaat
gacgatgaccaaaataatggtataaatatgaatattaataataatgataagtgtattcat
aataataatgataaatgttgtagtaataataataacaatgataaatgttgtagtaataat
aataacaatgataaatgttgtattcataataataatgataagtgtattaataataataat
gataagtgtattaataataataatgataagtgtattcataataataatgataaatgttgt
attcataataataataaatgtagtaataatatgaatgaaaaaattttgattgatgtgaaa
caaacctttcaatatttatttgaaaataaattaattactattccttatgaacaagaaaag
aattattatgaacatgtgtttaataaaatattccatattaatttctgtgatattaataaa
atttttacttttcaatatattaatcagaatattaatcctaatatattaatgaaatataat
ataacacaaaaaattaacatttttaaaaaattatatcataattataaaggaaaaaatatt
actactgataaacaaacttcttttttcaccttaccatttataacaatcttattaattttt
aaagatatcgaattcaataaaaacctattccaaaacttatatgttgaatttataaaatat
attttccttatgaatataaatcttcaacaatatgatcttttcgtttatgatatattaaag
gacgatgatccgattgcatgtacagaattgttttcttatgtacagtcagcgtcaagtata
atggagttcatttttaattactccttagttcaatatatatacgttaaagggtttctacct
gatgttttactcatgatctttgccttctgcataaattccgaaataaatttaaaaatccac
tttgatatatatgaacaaatacttatgtcacataacaaaaatataaagaacgttttccag
ttttttggcctcaacgttgaaaagttaaaaaatttcgagttaaaaaatgttgatgatctt
ttcgatgcttccgcaaacattttaaagggaaaattaaatattgaccagatatatgaaaat
ttggaatggataaaaattaagagattttattatgcaatgattatttatgattgttataat
gatgacgtatatcaagtagctaaaaagtaccgattaaaattaaaagaaataaaaactgta
tatttaagatgtatatttaatctttcttacaattgtcgaatcctaaaaaattttaaaaac
tctttggatatattctgtattattttagaaaatttgttggcgaaaatgaagacaaaaaat
ttcccttttatttaa

DBGET integrated database retrieval system