KEGG   Plasmodium falciparum 3D7: MAL13P1.166Help
Entry
MAL13P1.166       CDS       T00095                                 

Definition
(RefSeq) DEAD box helicase, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD ResIII Helicase_C
Motif
Other DBs
NCBI-GeneID: 813719
NCBI-ProteinID: XP_002809047
PlasmoDB: MAL13P1.166
GeneDB: MAL13P1.166
UniProt: C0H5F0
Position
13:complement(join(1300104..1300173,1300314..1300412,1300605..1300718,1300918..1301140,1301265..1303074,1303336..1304416,1304615..1304744,1304950..1305010,1305214..1305295,1305428..1305492))
Genome map
AA seq 1244 aa AA seqDB search
MFEKKKKKVKNKNSIHLQCYRRLGIHRKKYFNFSNQLIYISLSGHIYTYPSYEGVLQADK
YILDELCITKFGESSAITDIKLLYKKIYKNDYDPSKYTKQNFEHYYIPPSIIKAYNELGI
HKLYKEQAECLCKIFLNDDIENKIKNGIYMNHGNNEEFVSNENTHCKSNVEVNTDISMNL
DFFCDMNIVDMKNIKYTPGKKEDIQIDEFTDLIKSDITFGKKKNVDICNHMDNKMKVYTN
EYTNEYTNEYTNEYTNEYTNEYTNECSNEDTNEYNLNNSHSKYDTLVNVENSSYKKRSQI
CYWSNNNNNNNNKFYNNFLFKIPTGMGKTLIYDILIIRQVLYKGFRVILTLPTLSLINEK
YEYYDKLFGDQTVSLNIKKFNSNDFTGYSYSLSTDLALCTFEQANTILSIIIKNNLKFNY
LFILDEIHYINNQKRGFHIESLLTKIKYIQKNFSHIYNIKVYGFSATISNIDQLAEWLDA
NVYESKTKLQRIKYLYKIDNSLYKDINKNEVERTLENCNTLDPNHLGYLISEEFILKKNV
LIFCPSKNKSEQTASFISSTLPYYLNKRDYKINMELQEKRFKLLNDLKGLTIKVANVEKM
IMNGIFYHHSGLNINEKSLIENSFRNNILFCLCCTTTLSVGINMNIHTIIIRSLKLGKSF
ITKDEITQMAGRCGRSQKKLYDSTSSCKNFDESTNKSYMTPDRRYTDSSGLPPILDYDYD
CDGKVIIFVSNVEKHYLEKILYDEEEMSKLKTTLNNIQMCKFLLDFIHLKLIKTKKDMFD
FLYLYSIKFFKAKRVEGNTNDDDQNNGINMNINNNDKCIHNNNDKCCSNNNNNDKCCSNN
NNNDKCCIHNNNDKCINNNNDKCINNNNDKCIHNNNDKCCIHNNNKCSNNMNEKILIDVK
QTFQYLFENKLITIPYEQEKNYYEHVFNKIFHINFCDINKIFTFQYINQNINPNILMKYN
ITQKINIFKKLYHNYKGKNITTDKQTSFFTLPFITILLIFKDIEFNKNLFQNLYVEFIKY
IFLMNINLQQYDLFVYDILKDDDPIACTELFSYVQSASSIMEFIFNYSLVQYIYVKGFLP
DVLLMIFAFCINSEINLKIHFDIYEQILMSHNKNIKNVFQFFGLNVEKLKNFELKNVDDL
FDASANILKGKLNIDQIYENLEWIKIKRFYYAMIIYDCYNDDVYQVAKKYRLKLKEIKTV
YLRCIFNLSYNCRILKNFKNSLDIFCIILENLLAKMKTKNFPFI
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaaaaaaaaaaaaaaaagtaaaaaataaaaattcgattcatttacaatgttat
cgaagattaggtattcatcgaaaaaaatatttcaatttttcaaatcagttgatatacatt
tctttgtctggccatatttatacatacccaagttatgaaggggtgttacaggcagacaaa
tatattctcgatgaattgtgcataacaaaatttggggaaagctctgcaattactgatata
aaattattatacaaaaaaatatacaaaaatgattacgatccttctaaatatactaaacaa
aactttgaacactattacataccaccttcaattattaaagcatataacgaactaggtata
cacaaactatataaagaacaagcagagtgtctttgtaaaatatttttaaatgacgatata
gaaaataaaataaaaaatggaatttatatgaaccatggaaataacgaggaatttgtatca
aatgaaaacacgcattgtaaaagtaatgtagaagtaaatacagatatttcaatgaattta
gattttttttgtgatatgaatattgtagatatgaaaaatataaaatacacacctgggaaa
aaagaagatatacaaattgacgaatttacagatttgattaaaagcgatataacatttggt
aagaagaaaaatgtggatatttgtaaccacatggataataaaatgaaggtatatacaaac
gaatatacaaacgaatatacaaacgaatatacaaatgaatatacaaacgaatatacaaat
gaatatacaaacgaatgttctaatgaagataccaacgaatacaatcttaataacagccat
tctaaatatgatacacttgttaatgttgaaaattcatcatataaaaaaaggtcgcagata
tgttactggagtaataataataataataataataataaattttataacaatttcctattt
aaaatacctacaggtatgggaaaaacattaatttatgatattcttattattcgtcaagtt
ttatataaaggttttagagttattttaaccttaccaacattatctctaataaatgaaaaa
tatgaatattatgataaattatttggtgatcaaacagtatcattaaatattaaaaaattt
aatagtaatgattttaccggatattcatatagtctatcaacagatttggcattatgcaca
tttgaacaagcaaacaccattttaagtattatcattaaaaataatttaaaatttaattat
ttatttatacttgatgaaattcattatataaataatcaaaagaggggatttcatattgaa
tccctcttaacaaaaattaaatatatccagaaaaattttagtcatatttataatataaag
gtatatggcttttctgcgactatttccaacattgaccagctagctgaatggctagacgcc
aatgtgtatgaaagcaaaacgaaacttcaacgaataaaatacctgtataaaatagacaac
tcattatacaaagatataaacaaaaacgaggtggagaggacgttggaaaattgtaatacg
ttggatccgaatcatttgggatatttgataagtgaagaatttattttaaaaaagaatgtt
ttaatattttgtccatcgaaaaataagagtgaacagacggcttcatttataagtagtaca
ctgccttattatttgaataagagagactataaaataaatatggaattacaagaaaagcgg
tttaaattattaaatgatttgaaaggtttgacaataaaagtagcaaatgttgaaaagatg
attatgaatgggatattttatcatcattcaggattaaatattaatgagaagagtcttatt
gaaaattcttttcgaaataatatattattttgtttgtgttgtacaacaacattatctgta
ggaataaatatgaatattcatactataataattcgtagtttgaaattaggaaaatcattt
ataacaaaagatgaaatcacacagatggcaggacgatgtggaagatctcagaaaaaattg
tatgatagtacttcaagttgtaaaaatttcgatgaaagtacaaataaaagttatatgaca
cctgatagaagatatactgattcaagtggcttacctcctatattagattatgattatgat
tgtgatgggaaagttataatatttgtgtccaatgtagaaaaacattatttagaaaaaata
ttatatgacgaagaagaaatgtctaaattaaaaactacattaaataatatccaaatgtgt
aagtttttattagattttattcatttaaaattaataaagacaaaaaaagacatgtttgat
tttttatatttatatagcatcaaattttttaaggcaaaacgtgtagaaggcaacacaaat
gacgatgaccaaaataatggtataaatatgaatattaataataatgataagtgtattcat
aataataatgataaatgttgtagtaataataataacaatgataaatgttgtagtaataat
aataacaatgataaatgttgtattcataataataatgataagtgtattaataataataat
gataagtgtattaataataataatgataagtgtattcataataataatgataaatgttgt
attcataataataataaatgtagtaataatatgaatgaaaaaattttgattgatgtgaaa
caaacctttcaatatttatttgaaaataaattaattactattccttatgaacaagaaaag
aattattatgaacatgtgtttaataaaatattccatattaatttctgtgatattaataaa
atttttacttttcaatatattaatcagaatattaatcctaatatattaatgaaatataat
ataacacaaaaaattaacatttttaaaaaattatatcataattataaaggaaaaaatatt
actactgataaacaaacttcttttttcaccttaccatttataacaatcttattaattttt
aaagatatcgaattcaataaaaacctattccaaaacttatatgttgaatttataaaatat
attttccttatgaatataaatcttcaacaatatgatcttttcgtttatgatatattaaag
gacgatgatccgattgcatgtacagaattgttttcttatgtacagtcagcgtcaagtata
atggagttcatttttaattactccttagttcaatatatatacgttaaagggtttctacct
gatgttttactcatgatctttgccttctgcataaattccgaaataaatttaaaaatccac
tttgatatatatgaacaaatacttatgtcacataacaaaaatataaagaacgttttccag
ttttttggcctcaacgttgaaaagttaaaaaatttcgagttaaaaaatgttgatgatctt
ttcgatgcttccgcaaacattttaaagggaaaattaaatattgaccagatatatgaaaat
ttggaatggataaaaattaagagattttattatgcaatgattatttatgattgttataat
gatgacgtatatcaagtagctaaaaagtaccgattaaaattaaaagaaataaaaactgta
tatttaagatgtatatttaatctttcttacaattgtcgaatcctaaaaaattttaaaaac
tctttggatatattctgtattattttagaaaatttgttggcgaaaatgaagacaaaaaat
ttcccttttatttaa

DBGET integrated database retrieval system