KEGG   Plasmodium falciparum 3D7: MAL13P1.204Help
Entry
MAL13P1.204       CDS       T00095                                 

Definition
(RefSeq) exoribonuclease PH, putative
  KO
K12589  
exosome complex component RRP42
Organism
pfa  Plasmodium falciparum 3D7
Pathway
RNA degradation
Module
Exosome, archaea
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MAL13P1.204
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     MAL13P1.204
 Prokaryotic Type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     MAL13P1.204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:complement(1604571..1605407)
Genome map
AA seq 278 aa AA seqDB search
MSSLNYIEDSINCNIRIDGRTLLTYRSIEINKNILVSGDGSSSVINEENNVICGIKLSLI
TPDVDTYDEGNVNLQIDCPASVAANRIKKDHLQTMTTIIYNLCIKNNINKKILCILPGKF
AWSVDINVMVLNAGGGLLDIISIAIYVALKDTFFPIVKPKKEIEEENTFHEISNKDYQLE
IVENEHVNFPYENIPICISIGEINNKYIYDMSKVEEELVQNIFVVAITSKGKCVAFHKLY
GISMEISSILNITENSSKISHTLFDKIHQALDKIHANM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgttaaattatattgaagacagcattaactgcaatataagaatagatggtcga
accttattaacgtacagatctatagaaataaataaaaacattcttgtgtcaggtgatggg
agtagtagtgtaataaatgaagaaaataatgtaatttgtggaattaagctttctttaata
actcctgatgttgatacatatgatgaaggtaatgtaaacttacaaattgattgtccagca
tctgttgctgctaatagaataaaaaaagatcatttacaaacaatgacaacaattatttat
aatttatgtataaaaaataatataaataaaaaaatattatgtatcctcccaggtaaattt
gcctggagtgttgatataaatgttatggttcttaatgctggaggaggcctattagatatt
attagcatagccatatatgtagctttaaaagatacgtttttccctattgttaaaccaaaa
aaagaaattgaagaagaaaatactttccatgaaatttcaaataaagattatcagctagaa
attgttgaaaatgaacatgtaaattttccatatgaaaatatacctatctgtatatctatt
ggggaaatcaataataaatatatttatgatatgtccaaagtcgaagaagaacttgttcaa
aatattttcgttgtagctattacgtctaaagggaaatgtgtagcattccataaattatat
ggtatatccatggaaatatcatccattttaaatattactgaaaattcctctaaaatttct
catacgctttttgataaaattcatcaagcattggataaaatacacgcaaatatgtag

DBGET integrated database retrieval system