KEGG   Plasmodium falciparum 3D7: MAL13P1.204Help
Entry
MAL13P1.204       CDS       T00095                                 

Definition
exoribonuclease PH, putative
Orthology
K12589  
exosome complex component RRP42
Organism
pfa  Plasmodium falciparum 3D7
Pathway
RNA degradation
Module
Exosome, archaea
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:pfa03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:complement(1604571..1605407)
Genome map
AA seq 278 aa AA seqDB search
MSSLNYIEDSINCNIRIDGRTLLTYRSIEINKNILVSGDGSSSVINEENNVICGIKLSLI
TPDVDTYDEGNVNLQIDCPASVAANRIKKDHLQTMTTIIYNLCIKNNINKKILCILPGKF
AWSVDINVMVLNAGGGLLDIISIAIYVALKDTFFPIVKPKKEIEEENTFHEISNKDYQLE
IVENEHVNFPYENIPICISIGEINNKYIYDMSKVEEELVQNIFVVAITSKGKCVAFHKLY
GISMEISSILNITENSSKISHTLFDKIHQALDKIHANM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgttaaattatattgaagacagcattaactgcaatataagaatagatggtcga
accttattaacgtacagatctatagaaataaataaaaacattcttgtgtcaggtgatggg
agtagtagtgtaataaatgaagaaaataatgtaatttgtggaattaagctttctttaata
actcctgatgttgatacatatgatgaaggtaatgtaaacttacaaattgattgtccagca
tctgttgctgctaatagaataaaaaaagatcatttacaaacaatgacaacaattatttat
aatttatgtataaaaaataatataaataaaaaaatattatgtatcctcccaggtaaattt
gcctggagtgttgatataaatgttatggttcttaatgctggaggaggcctattagatatt
attagcatagccatatatgtagctttaaaagatacgtttttccctattgttaaaccaaaa
aaagaaattgaagaagaaaatactttccatgaaatttcaaataaagattatcagctagaa
attgttgaaaatgaacatgtaaattttccatatgaaaatatacctatctgtatatctatt
ggggaaatcaataataaatatatttatgatatgtccaaagtcgaagaagaacttgttcaa
aatattttcgttgtagctattacgtctaaagggaaatgtgtagcattccataaattatat
ggtatatccatggaaatatcatccattttaaatattactgaaaattcctctaaaatttct
catacgctttttgataaaattcatcaagcattggataaaatacacgcaaatatgtag

DBGET integrated database retrieval system