KEGG   Plasmodium falciparum 3D7: MAL13P1.221Help
Entry
MAL13P1.221       CDS       T00095                                 

Gene name
atcasE
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MAL13P1.221 (atcasE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAL13P1.221 (atcasE)
Enzymes [BR:pfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MAL13P1.221 (atcasE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:join(1792612..1793100,1793222..1793719,1793907..1794047)
Genome map
AA seq 375 aa AA seqDB search
MIEIFCTAIVVITILIVGVFVYMIIRTKKKKLKLDNMFYINSKYKIDLDKIMTKMKNKSV
INIDDVDDEELLAILYTSKQFEKILKNNEDSKYLENKVFCSVFLEPSTRTRCSFDAAILK
LGSKVLNITDMNSTSFYKGETVEDAFKILSTYVDGIIYRDPSKKNVDIAVSSSSKPIINA
GNGTGEHPTQSLLDFYTIHNYFPFILDRNINKKLNIAFVGDLKNGRTVHSLSKLLSRYNV
SFNFVSCKSLNIPKDIVNTITYNLKKNNFYSDDSIKYFDNLEEGLEDVHIIYMTRIQKER
FTDVDEYNQYKNAFILSNKTLENTRDDTKILHPLPRVNEIKVEVDSNPKSVYFTQAENGL
YVRMALLYLIFSSTS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatattttgcactgcaattgttgtgatcaccatattgattgtgggggttttt
gtttatatgattataagaacaaaaaaaaaaaaattaaaattagataatatgttttatatc
aatagcaagtataaaattgatttggataaaatcatgacgaaaatgaaaaacaaaagtgta
attaatattgatgatgtagatgatgaggaattattggctatcttatatacatccaaacaa
tttgaaaaaatattaaaaaataatgaagatagcaaatatttagaaaataaagttttctgt
agtgtgttccttgaaccaagtacaagaacaagatgttcttttgatgctgcaattttaaaa
ttaggttccaaggttttaaatatcactgatatgaattcaacttctttttataagggagaa
actgttgaagatgcctttaaaatattgtcaacatatgtggatggaattatatacagagat
ccatcaaagaaaaatgtcgatattgctgtttcttcttcaagcaagccaattattaatgcc
ggtaatggaacaggcgaacatccaactcagtccctcttagatttttatacaattcataat
tactttccatttattctagatagaaatataaataaaaagcttaatatagctttcgttgga
gatttgaaaaatggaagaactgtacattcacttagcaaactacttagcagatacaacgtc
agttttaatttcgtttcatgtaaatcgttgaatattcctaaagatatagtaaatacaatt
acgtataacttaaaaaaaaacaatttctatagtgatgattctatcaaatattttgataat
ttagaggaaggattagaagacgttcatataatttatatgaccagaatacaaaaagaaaga
tttactgatgtggatgaatataatcaatataaaaacgcattcattctgagtaataaaact
ttagaaaacacaagagacgacacaaagatacttcaccctcttccaagagttaacgaaata
aaagttgaagtagatagtaatccaaaaagtgtttatttcacacaagcagaaaatggatta
tatgtaagaatggctttattatatctcattttttcatcaactagctag

DBGET integrated database retrieval system